Sh_012A01_p000120

Overview
NameSh_012A01_p000120
Unique NameSh_012A01_p000120
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length112
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_012A01contigSh_012A01:90089..90488
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
EC2.6.1.34
InterProIPR004813
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_012A01_t000120Sh_012A01_t000120R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_012A01_p000120 ID=Sh_012A01_p000120|Name=Sh_012A01_p000120|organism=R570 Sugarcane cultivar|type=polypeptide|length=112bp
MPPATAVNYNSWLLIGVAFNFFFFQYRKRWWQWYNYILSAALDAGMAFMG
VLLYFTLSIENRNISWWGADGEHCPLASCPTARGWIWALTVSALSCDQRL
PTVLMQVTAGM*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0055085transmembrane transport