Sh_012A01_p000130

Overview
NameSh_012A01_p000130
Unique NameSh_012A01_p000130
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length110
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_012A01contigSh_012A01:91196..91525
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR004813
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_012A01_t000130Sh_012A01_t000130R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_012A01_p000130 ID=Sh_012A01_p000130|Name=Sh_012A01_p000130|organism=R570 Sugarcane cultivar|type=polypeptide|length=110bp
MYVIMPVAYWGLDLYNARRFPILSSHLFMFNGKSYDITSIVNDRFEIDMD
VYQRSGRINMSTLFALSYSLSFAAIAATITHVALSTASRSTAASTRCSRR
TTSPTSTRG*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0055085transmembrane transport