Sh_012J16_p000090

Overview
NameSh_012J16_p000090
Unique NameSh_012J16_p000090
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length314
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_012J16contigSh_012J16:23114..26147
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
EC5.4.99.5
InterProIPR008238
InterProIPR020822
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_012J16_t000090Sh_012J16_t000090R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_012J16_p000090 ID=Sh_012J16_p000090|Name=Sh_012J16_p000090|organism=R570 Sugarcane cultivar|type=polypeptide|length=314bp
MASKLGTKAAAASPAAAHRGGLARGPQGTSRVAFGPAASRTKGLRAANNS
VTPMAKEQRVDRSDIFELDSIRQVLIRLEDSIIFGLLERAQYCYNADTYD
SKAFHMDGFEGSLVEYMVRETEKLHAQVGRYNSPDEYPFFPEDLPEPRLP
PIQYPKVLHPVADSININKEIWKMYFDELLPRLVKEGSDGNAGSSAVCDT
TCLQALSKRIHYGMFVAEAKFQESPEAYMPAIIAQDRDQLMHLLTYETVE
RAIEQRVEAKAKIFGQEVKIGAEDNSNPPVYKMRPSLVAELYSYRIMPLT
KEVQIAYLLRRLD*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0004106chorismate mutase activity
Vocabulary: Biological Process
TermDefinition
GO:0009073aromatic amino acid family biosynthetic process
GO:0046417chorismate metabolic process