Sh_012J16_p000110

Overview
NameSh_012J16_p000110
Unique NameSh_012J16_p000110
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length169
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_012J16contigSh_012J16:45962..46578
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR003245
InterProIPR008972
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_012J16_t000110Sh_012J16_t000110R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_012J16_p000110 ID=Sh_012J16_p000110|Name=Sh_012J16_p000110|organism=R570 Sugarcane cultivar|type=polypeptide|length=169bp
MATAAATRLLLVVLLLFAATPAPSLAESFVVGGRKHRWAPNINYTDWADQ
NQFHVGDWLEFKYEKGKYDVVQVNETAYAACDANSPILSYSRGHNFVFRL
NQTGRFYFICSRGYCWNGMKVSVLVQPPAVAPAPHASSASAGAAAGVWSA
ALAALLGWAVVRPLPFRV*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0009055electron carrier activity