Sh_012J16_p000120

Overview
NameSh_012J16_p000120
Unique NameSh_012J16_p000120
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length153
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_012J16contigSh_012J16:47540..48140
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_012J16_t000120Sh_012J16_t000120R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_012J16_p000120 ID=Sh_012J16_p000120|Name=Sh_012J16_p000120|organism=R570 Sugarcane cultivar|type=polypeptide|length=153bp
MILIVVLRNWALLSHSTHYFKSIVLAILGDYHILVGSVACTPCFCLDSLV
AFVVQFRFWIPAYIFLFLLLDTSTFCHLTMIFSLEYLREEYELNQRFGSL
DFKLKFVEHNIHFLQEVLQNRRSDLLEWGVIILLIIEIAISLYEIVKDSM
IS*
back to top