Sh_012J16_p000160

Overview
NameSh_012J16_p000160
Unique NameSh_012J16_p000160
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length275
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_012J16contigSh_012J16:88850..103797
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR034347
InterProIPR004046
InterProIPR010987
InterProIPR012336
InterProIPR004045
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_012J16_t000160Sh_012J16_t000160R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_012J16_p000160 ID=Sh_012J16_p000160|Name=Sh_012J16_p000160|organism=R570 Sugarcane cultivar|type=polypeptide|length=275bp
MAPMKLYGAVLSWNVTRCAAALEEAGSDYEIVPINFATAEHKSPEHLARN
PFGQVPALQDGDLYIFVFRLDPFGQVPALQDGDLYLFESRAICKYAARKN
KPELLREGNLEESAMVDVWMEVEANQYTSVLNPILFQVLISPMLGGTTDQ
KVVDENLEKLKKVLEVYEARLTKSKYLAGDFLSLADVNHVSVTLCLLATP
YASVLDAYPHVKAWWSSLMERPSVQKVAAMISRPATGHDEAICLKGLPYQ
SVNEFVLGICLFSDVSSTLKVQCL*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding