Sh_012J22_p000020

Overview
NameSh_012J22_p000020
Unique NameSh_012J22_p000020
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length222
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_012J22contigSh_012J22:39583..45028
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR010987
InterProIPR004045
InterProIPR012336
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_012J22_t000020Sh_012J22_t000020R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_012J22_p000020 ID=Sh_012J22_p000020|Name=Sh_012J22_p000020|organism=R570 Sugarcane cultivar|type=polypeptide|length=222bp
MWPAPRPSHSRSALRSPSPSLAASETCFGPFTQRVLLTIEEKHLPYELKL
VDLANKPDWLFEINPEGKVPIVKFEEKWIGDSDVITQTLEEKYPEPPLAT
PPEKASVGSKIFSTFIGFLKSKDPSDGTEEALLNELTSFDSYLKDNGPFI
NCGTISAADLSLGPKLYHMEIALGHYKNWSVPDSLSHVKTYMKSIFSTDS
FVKTQALPEDVIAGWRPKVMG*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding