Sh_012J22_p000060

Overview
NameSh_012J22_p000060
Unique NameSh_012J22_p000060
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length408
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_012J22contigSh_012J22:69065..70333
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_012J22_t000060Sh_012J22_t000060R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_012J22_p000060 ID=Sh_012J22_p000060|Name=Sh_012J22_p000060|organism=R570 Sugarcane cultivar|type=polypeptide|length=408bp
MAEPAASSSSSGSFAPRRLHGAGVVRDELPYSGLAAPPPPLPPVQVQVAA
SGGGGGGGGGGGGGKISPAVLFIIVILAVVFFISGLLHLLVRVLVKKQHR
RGGRGGTASSSSAAAVRGAGGDAGGADVALQRQLQQLFHLHDSGLDQAFI
DALPVFAYREIVVGGGGDGDKEPFDCAVCLCEFDAEDRLRLLPLCGHAFH
LNCIDTWLLSNSTCPLCRGVLFVPGLMGEDSPMFDFEERLEEGRLSEDCD
DGFGLPGMKATGLAQTPVAEKKVFPVRLGKFKNVGTQGAVEGESSSSSLD
GRRCFSMGTYQYVLGTSELRVALQPGRIRNGAGGAMRGRPPGLSSINADI
MEGKKICARNKGESFSVSKIWQWSNLKGKLPAGSDECSDAGSLPWMKRGG
AADTSNL*
back to top