Sh_012J22_t000020

Overview
NameSh_012J22_t000020
Unique NameSh_012J22_t000020
TypemRNA
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length666
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_012J22contigSh_012J22:30475..45276
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Properties
Property NameValue
NoteGlutathione S-transferase DHAR3, chloroplastic
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
Sh_012J22_g000020Sh_012J22_g000020R570 Sugarcane cultivargene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Sh_012J22_p000020Sh_012J22_p000020R570 Sugarcane cultivarpolypeptide


Sequences
The following sequences are available for this feature:

mRNA sequence

>Sh_012J22_t000020 ID=Sh_012J22_t000020|Name=Sh_012J22_t000020|organism=R570 Sugarcane cultivar|type=mRNA|length=666bp
ATGTGGCCCGCGCCTCGGCCCAGCCACTCGAGGTCTGCGCTAAGGAGTCC
ATCACCGTCCCTGGCCGCCTCGGAGACTTGTTTTGGTCCTTTCACACAGA
GGGTTTTGTTGACTATAGAGGAGAAGCATCTGCCTTATGAACTGAAGCTA
GTTGATCTAGCTAATAAGCCGGATTGGTTATTTGAAATCAACCCAGAAGG
TAAAGTGCCTATCGTGAAGTTTGAGGAAAAATGGATTGGTGATTCTGATG
TTATAACACAAACATTAGAGGAGAAGTATCCTGAACCACCCTTGGCAACT
CCACCAGAAAAAGCTTCAGTTGGGTCAAAAATATTTTCCACTTTCATTGG
TTTCCTCAAAAGCAAAGATCCAAGTGATGGAACAGAAGAGGCACTACTTA
ATGAGCTTACTTCATTTGATAGTTATCTAAAAGACAATGGTCCATTTATT
AATTGTGGAACAATTTCTGCTGCTGATCTCTCTCTGGGCCCTAAACTATA
TCACATGGAGATAGCCCTGGGTCACTATAAGAACTGGTCTGTTCCAGATT
CACTTTCTCATGTAAAAACATACATGAAGTCGATTTTCTCAACGGATTCT
TTTGTCAAAACTCAAGCTCTGCCAGAGGATGTAATTGCTGGATGGCGCCC
AAAAGTCATGGGTTAA
back to top

protein sequence of Sh_012J22_p000020

>Sh_012J22_p000020 ID=Sh_012J22_p000020|Name=Sh_012J22_p000020|organism=R570 Sugarcane cultivar|type=polypeptide|length=222bp
MWPAPRPSHSRSALRSPSPSLAASETCFGPFTQRVLLTIEEKHLPYELKL
VDLANKPDWLFEINPEGKVPIVKFEEKWIGDSDVITQTLEEKYPEPPLAT
PPEKASVGSKIFSTFIGFLKSKDPSDGTEEALLNELTSFDSYLKDNGPFI
NCGTISAADLSLGPKLYHMEIALGHYKNWSVPDSLSHVKTYMKSIFSTDS
FVKTQALPEDVIAGWRPKVMG*
back to top

mRNA from alignment at Sh_012J22:30475..45276-

Legend: exonpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>Sh_012J22_t000020 ID=Sh_012J22_t000020|Name=Sh_012J22_t000020|organism=R570 Sugarcane cultivar|type=mRNA|length=14802bp|location=Sequence derived from alignment at Sh_012J22:30475..45276- (R570 Sugarcane cultivar)
GCGGTCAGATAAGCTTCTCTCTCCGCTTCCCCTCCCGGGCCACAACCGCT CGCCGCGTGCTCCTGTCGTGACTGCACCGCATCCTCCCCCGCGCCGACCT GCTCCGGCGAGTTAGGCATGGCCGTCCTCCTCCGCGGCACCTCCGCCGCC GCCACGGCCGCTGGCCCCTCCTCAGCGCTGCTCGCCACCACCTTCCGCCG CTCCCGCGGCCGCCTTCTGCCCCCGTGCCGCGCCACAGCGCCGCTTGTAT GTGGCCCGCGCCTCGGCCCAGCCACTCGAGGTCTGCGCTAAGGAGTCCAT CACCGTCCCTGGCCGCCTCGGAGACTGTAAGCTCTCTCTCTCTCTCTCTC TCGCGCGCGCGCGCTGGGTTAATGTAGTCTATAGAATGCAAGGTGAACTG ACAACAATGCTGATTGCGTATTAGCTATATTGGATTCAGGGAGGTTTTAA TTTGCTGCGTTAAGAGTGCAACTGCAAATGATAGTTTTGTTTCACGTTTA GAGTAATGGTATATATTGGTATTTGATTTTCGTGTTGGTATCATGACCCG TATGTGGTTTATGAAGACACGCGAAAAAATATATATATAATAACCTGAGA TTGCATGAAATGCGTGGTGGTAGGTTTTAGCTAAACAGCAGCATTTGACA TGTCTGCGATTTGGATGTAGTTATTTCAGCACATAGCTTGGTCCTGCAGT CTGTACCAAGCCAATTTTGTGGTAAATAGCATTTGATTTAGTGCACTTGT TCTAGTCGTCATCTTCATGACAATATAAACAGTGTATGTTCTCTGCATAG TTCTTAGGGCGTAAAGGCGAGGCACGGCGATGGGGGAGCGCCTGGACGCC TAGGCGCCCGCCTTGCCCGCCTAGGCGCCCATTCTGCAAGGCGATGGGGG GGCGCCTGGACGCCTAGGCGTCGCCTAGGCGACGCCATGAGAACTATGGT TCTCTGAATCATTTAGCTAACAGCAATGCATGGAAAATCCAAAGGTGCAC TTCTATGACGAGTTTATATTTGGAGAAATTTTTTCCAGTGCTTGGTGAAG GTTGGGTGATTTGTATTTTCAGTGTTTTGGTGAAGTTTGATATTAATGTA ATATAGTATATTAAGAGATGAACATGTTGAGGTTGCTTTGGAGTGAAATT TCTTGCTTAATTAAAATGCTGTCTCCTGCCCTACACCTCTTTGAAGCTTT ACCGGGGACAATAGAATGTGTTAATGCCTTAATGACAAAAAAGTTTCTGG ACTCTGGATATGATGCATTCCTGTTTTTCTGTATGCTTAAGCTGTATTGG TAGTCCTTGTTGTCAATTTGTGCCATGTGGAAGGAATGATACAATATAAG AATAGAGGAGCTCATTTTGTATAGAAAAACAAAATATTTGTACTGGGAGT TTTAGCTTTCACAGAATAACTGTTTCTGTGATAGAAATAGAATAACAGCA TTCAGAAACAAACTAGAGTAGGTTTATCTTTTTCTAATCTATGTTTGCTT ATTAATAGCAAAACTTGCGCTGCAGTCTGGTACATGCTTAGCTCAAGTAG GGAAACTACTGCCAGCATAATTCACAGTATAACATTAGGCATCAGCAGTT TATCTTATTAATAGTGAGTTTATTGATATGAGTAGATATTAATGGTTACC TGAACACTGGCTCACTTAGACAGCCTGGGTTTGAGACACACATCTCCTTT GAAAGAGACGAAGAGGGGTGGTGGGGTGTTTTCAAAGTAGACATTTGAAA GATTAATATTGGCATCTGTTTGGTACTATGGGGCTACATTGATATTACCA GAATGGAAGTGTGTGTCAATCCTGTTTCCTTTATATTAGAATGTAACACC GCAGTTTAAGGTTTTTAACTGCATTGCAAGTATTTTTGCTCTGATTATTG AAATACTTGACATTCTAAGTTAAATTTCCATGTTGGCCACAGGTCCTTTC ACACAGAGGGTTTTGTTGACTATAGAGGAGAAGCATCTGCCTTATGAACT GAAGCTAGTTGATCTAGCTAATAAGCCGGATTGGTACCTATCTGCAAGAC AAGGCTAACCTTTCTGAATTCAGAATTTCAGATTATTACTGGATGTTTCT CTGCTTGATAGTTCCATGGCCATGAGCCCATGAACCATCATGCTTTTGTC TTGCTTCATTAGGTTATTTGAAATCAACCCAGAAGGTAAAGTGCCTATCG TGAAGTTTGAGGAAAAATGGATTGGTGATTCTGATGTTATAACACAAACA TTAGAGGAGAAGTATCCTGAACCACCCTTGGCAACTCCACCAGAAAAAGC TTCAGTGTATGTGATATTTCCAGTGCCCTAATTAATAACTCCTGTTTTGC ACTTTTGTAAGGGTGTTCAGCACTCTTGTTGCAAATGTTGAGTCATCCAC TCATATTTTGTGCTAATTTCTCTCTCATTATCTGTTTCATTTTCGTGCTG ACCATTTATGCATGACGAACTGGTCTAAGCGTTTAAACTTTGGGTGTGTT TGTATTATTTGTGGACTGATGCCTCTTTTATAAAGAGGACTGAAACCGGA ACTTCTCCATCATCTAAGAAAAGCATACAAACTATTATATTTTCCTTTCC ATATATCCCCTTAACAGAATATGTGATTCATTCATTGTGGTTGTTCAAAA ATATGCCTTATCATTAACAGAGTTGGTATCTATGACACTAAATTAGTGAC TTTATTGGTACATCCTACATGGAAATGTTGTTTGATTTGTATCTTGAAGC CATCTGTAACTTTAGCCTGTTATTTTTTTCCCCAACTTGCTTGGGACAAA AGGCTATGTTGTTGTTATTAATACTCACAGTTCTATTATTATGAGCGTCA TAATTATTGTGCATAAATTTCATTACAGTGGGTCAAAAATATTTTCCACT TTCATTGGTTTCCTCAAAAGCAAAGATCCAAGTGATGGAACAGAAGAGGC ACTACTTAATGAGCTTACTTCATTTGATAGTTATCTAAAAGACAATGTAA GTGGGCTGGTAGCAATTGTAATGCTACATGAATGGTTCATAATAGTACAA TTGTTTTGCATGAGGTGCAATATTTGTATAATTTCTGCAGTCCCCTTCTA CTTGTCATATCTACATACTTGTTTAGATTCCTGTGCATTGTTGCATGAAT TATACCATGTTTGATGTCAGACATAAAAAAAATCTGCAAATTCCTCTAGA ATCCATCAGCTGGTGCACATTTGACAGATGTATCCAAAATTTCCATATCT TTAAATGATTCAGATCCGTTGATACTCCCTCCATCCATAAAAGAATACAA CTATGGGATCCATGCTGGTCAAACTAGCTCAAGTTTGACCAAGTTTATAG TAAATAGTATTAACCTTTATGTCTCCAAATAAATTTATTATGAAAATATA TTATTTTTTATAATGAATGTCAGTACTTTTTTATATAACTTTAGTCAAAG TTTAAACTGTTTTACTCCTCGAGAAGCGAGAATTGCATTCTTTTGTGGAT GGAGGGAGTATGTATATATAAATTGAACTAGATGCTATTGTTTGTTTCCT GTCTCATTTTCCCTATGAGCCAGACTCATGTTTATGACCTATAACACTAG CCTTGCTTCATGTTCTACTAAGTCACATGTTACAATAATATGAAGCTACA TTTATGACCTATGATGCTAATCGTTGCAAAACAGTAATAGATTTTTGTGC TTCTACTTGTGGACTCATCACAACCGGTGTGTGTTTGATGGTTTGTCTCC AAACGTAGCTAGAGCTTTATTGCTCACTGGTGAGGAGTTGCAGTCTTGGG GTTTGACTGGGGCTAAAGGCATTACTTACCTCTCAGCCCTTGTTCCGAGC ATGAGTTGAGTTTAGGTGGAGGTTGTTTTATAATTTGTAAAAGATGCTAA TCTTCGCTTAGTCCCCTGGACAGTGTGGGTGCGTGTGTGTTTGTAAGGGC TCTTCCCCTTTTTTTTGTTCTTGATATTTTTTTTTGTAGAATCTGCAGGA GAGCTGCATATCATTGCATTAAGAAGGGGATAAATTAATAAATTACAACA CACTCACACACTCTTATATACTCATACAGGAAACAAACTTGCCTTTTACA TCAACCCACAACTTGACCCAACAAAACGCATCTTATTATCTATTAGCGAC CTCTAGGTGAGCAAGGCTACTAGCGCCTGCAAGGCCCCATAGGTGTGCCT CTTCAACGATTTCTTCTTAATATAATGATATGCAGCTCTCCTGCGCGTTC GAGAAAAAAGTGCTTTTACAGTGATTTTTCCGTGATGTATGTGTGAAAAT GGAGAAATTAAGCTACATGACACTGCCACATGTTTGCGTCATTGCATGCC AGAATTCAGATTAAACCTACATGGTTCTGATTTACCTCTACATGGTTTAG AATTATTGGTCATCTAAAATGTAGTTTTACCCTACAATGATTCCAAAAGT TGCCTTTTGCTCGTATCAAACTACTTAGTTTTAATAAACCAAATGCCCAT ATGGAAAATCTAAACTTTCAAGATCCTTGGATTGTTTAATATAACATCAG CACTTCTCAAATACAGAATATGGCGATTTATCATTTGCCTTCCATCAGCA ATCAGAAATGGAAACCTTGAGTTCTGTTCAAACTTATACAAACTTGATTC AAGTTTTATATCAGCTTAGATGAATTAGTTATATGATGTCTTAAATTACA TTCAGTCCATATGAAAGATGATGTTAACTTCACATGAACCTTTGTAGTTA TATGATATCTTAAATTATATTTGGTAACTTTGTATTCGTTTCTGTGTGGC TTATCTGAAATTTGCTGTGTAATTCTGGGACACTGTGTGGTGCAGGGTCC ATTTATTAATTGTGGAACAATTTCTGCTGCTGATCTCTCTCTGGGCCCTA AACTATATCACATGGAGATAGCCCTGGGTCACTATAAGAACTGGTCTGTT CCAGATTCACTTTCTCATGTAAAAACATACATGAAGGTACGTATCCATGT ACTGCACAATGATTTTTGTGCTTATCTTTCTGGTAATTAGTATTCAATGT CTTTAGGTCTGACATGTAACTGAACCAGAGTCTGATGCCATTTCTTTCGC CTAGCAGGCATCCACATCTGGCAAAAAAAAAACATGGAACAATGGTAGCT ATTAATAGTGCCATGAATTTGTTTCTGGCTTTCTTTCCACCTGAACAGCA GATACCAATGCTTGACCAGTTGCACAGTATATGCATGCTGTGTACTGCTC ATGTTTTATGAACTACACATTTAAGCAAAATTATTATTAAAGAACATAGT GGAGCCACAAAAGAAATAGTGCTTTGGGGGAGATTAGGGGATATATCAGA AAGTATCACTCATGAACCCAAATCCATGTTGACTCAATACTTGATTATCC CAATTCTTTACTAGCAGTGAATTGGCTATTCTTACATTGTATGCGTAATG CAAAACACGCCATTGAGAAATCAACATGCATTCTTTCCAAAGTATTAGCT AGGTATGAGAGGATTGTACCTTTTGATGCTAGCTTTTGTTTCTTTGACAT CTTCTTAAGGAGTTGGTCTTGGATATCCTAGCCTTACTTGATCATGTTCT TTCACAGTCGATTTTCTCAACGGATTCTTTTGTCAAAACTCAAGCTCTGC CAGAGGATGTAATTGCTGGATGGCGCCCAAAAGTCATGGGTTAAATTCAT TTCTAAAGTAAGACGTTAAGGTAAACTGCATATATCCCCTTAATAGAAGG AAGAAATATTGCATGCTTAGATTTCCTTGGTTTGCTATTTTGTGTCTATG GGAATAATGATGACAGGATGCACACCTCATAATTATCTAGAGAACTGGAA ACATGGGGGCTTTCTTAAGCTTCTTGTTGGCTAATAAGATGCAAAAATAT ATGTATGTATGTATTTCCAATGTATGTATAACTGTATTTGTATAAACATA CAAATACATTTATAAAGAATAAATAATTTAGTGAGTGTCTAGTGAGCCAT TGTGAGGAATTCTGCTATTTGCTTATAATACATGGGAAGATCAATATCCA TTGATGATAGTTAAGAGGACACCAATAGTAGTTCGCTTAAATGATGGGCT AATGATTGTGTAGTGGCTTCTTTGGTCTTCAATTTCTGAATTATGTGAGG CTAGAAGCTGTTAGTCGCTGGATTCTCACTCTTGGTAGCAGTAGAATCCT TACTCTCATCGAGAGAGGATGACACTAAGAGTTGGGGCAATTTTCTGGTT TATTTCTCACACAAACTCATACAATGTCATGCCAACCTGAGGGGTTGGGG TTACATACTTATAGGCTACTAGCCAGCCAAGCATATGCTAAGATGCTAGT CTAAGATGCTAGTTTAAGATGCCAATTGCTGTCCTAAAAACAGATGCTGT CCTAGATGCTGTCCTAGATGCTAACTGCTGTCCTAAAAGCAGATGCTGTC CTAGATGTTGTCCTAGATGCTAACTGCTGTCCTAACAACAGTCAAAAGAT GCTGGACACAAAGATCATGTGTTGCGTACTGCAGCAGCCCCACACCCACC AGCCAACACAGAGACTTTCCATCACTCTCCCCCTAAGTCTTGTGTGGCTC CTTGTGAGATATCTGAGCTATCCCGATCCTGGCGCGAAGTTCCTGGAACT TGACCCGCCCAAGGGACTTGGTCAGGAAGTCGGCGAGCTGGTCTTGGGTG TTGATGTAGTTGGCCCGGACACTCCCTCCAGGCAGCTTCTGATGAAGTGG TACCTCACCCGGATGTGCTTGCCGCGCTTGTGAAAGACAGAATTCTTTGC CAAGGCCAAGGCGGACTTGCTGTCCACCCTGAGTTCCACTGCTTCTGCAT CTTTGCCAAGGAGATCGCCAAGCAGCCGAGCCAGCCACAAAGCCTGAGTA GCGGCAGTAGTGGCTGCGATGTACTCTGCCTCGCAGCTGGACAGAGCCAC CACCTGCTGCTTGACCGACTGCCAGCTGATCGGACACTTACCGAGGAAGA ACAGAGTCCCGCTGGTGCTCTTGCTCGTGTCGATGTTGCCGGCATGGTCG CTGTCGCTGTACCCGATGAAATGCGCCGCACCGAGGCACCTCGGGTAGTG CAAGCCGTAGTCGGAGGTGCCTGCGACGTAGCGGAGGATCCTCTTCACGG CCTGCTGGTGCTCCGCCGTCGGTCGCTGCATGAACCGGCTGACGTAGCCG ACGGCGAACGCCAAGTCCGGTCGCGTGTGGACAAGGTAGCGAAGGCTGCC CACAATGCGCCGGTACTGCGTCGCGTCCACCTCCTCCGTACTCTCCCGAC TCAGCCTCAGCCTCTCCTCCATAGGAGTGTGGGCTGGGTTGCAGCCGGTG AGACCGCCTAGCTCCACAATGCGCTTGGCGTAGGCAGTCTGGCGAAGAGA GGTGCCGGAACTGTCCTGGTGGACCTCGATCCCCAGGTAGGAGAGAGGGC CCAAGTCGCTCATCTGGAAAGTCGCCCTCATCTTCTCCTTGAACGCCTCG ATCTCCACCTCCTTGGTGCCGGTGATCACCAAGTCGTCGACGTAGACGCC TACCAGCAGGGCCTTTCCTCCACTGCCTCGCCGGTAGATGGCCGCCTCGT GTGGACTTTGCTCGAAGCCCATCCCCTTCAGCGTGGAATCCAGCTTGGCA TTCCACGCCCTCGGTGCCTGCCGCAAGCCATAGAGGGCCTTGCGCAGGCG AAGCACCTTGCCCTCCTTGCCGGAAATCGCAAATCCTGGCGGCTGATGCA CGTAGACCTCCTCCTTCAAGTCGCCGTTAAGGAACGCCGACTTGACATCC ATGTGATGGACACGCCAACCCTCCTGGGCAGCTAGCGCAAGGAGTCGCAC GGACTCCATCCGTGCAACGGGCGCGAAGGCGTCGTCAAAGTCGATTCCTT GCTGGACGAAGCCGCACGCCACCAGACGCGCCTTGTGCTTGATCACCTTT CCGGTCTCGTCCTTCTTGAGCTTGAAGACCCACTTGAGAGAGATGGCGTG GTGGCCGGCTGAAAGATCGGCTAGCTCCCACGTCTTGTTCCGCTCAACGG CGTCCATCTCCATCTGCATCGCGGCACGCCATGCCGCGTCCCTCTCCGCC TCGGCGAAGGAACGAGGCTCGCCATCGTCCTGTGCGAGGTGCAACTCCGC CTCAAAGTCGTGCTGCGCCAGTCCAGGGACCGGCTGCTCGCCGAGGAGGT TGTCCACGGTACGGTAGCGCAGAGGCTCGCCGCCGTGGTAGGCGTCGATG CGATCCTCGTCGTTGGACAGCGGAGTGGCGAACTCCACTGTCCGCTGCTC GTCGTGGGCCGAAGTTGCCGGTGCCGAGCCTGAAGGGGTAGGGTCCGGTG TAGGAGAGCGAGGCGTGGCCGGCGGTGCTGGTGGTGGACTCGCCGGAGCC TGTGGACTTGTCGGAGCTGGTGGTGGCGGTGGTGAAGGACTCGCCGGAGG TGGTGGCGAACGAGGTGGTGGGGTAGGCGAGCTCGGTGAGGACGAGCTGC TAGCTCCCCCCGCCTCCTTGAAGTGGACGTAGTCGACGACGAAATCGCTG GTCGTCGGAGTCGAGCCGTCATCCACCATCTTGCCCCACGTCCAGCTTCG CCCCTCGTCGAACACGACGTCACGCGTGATGCGCACGCGCCGTGTCGCAG GGTCGAGGACGCGGTAGGCCTTGGCGCCCTCCGCGTAGCCGATGAAGACC CCTGGCGTGCTCCGGTCGTCGAGCTTGCCGACGTGGTTGAGCTCCTTGAC GAAGGTCAGGCAGCCGAAGACGCGAAGGTGGCTCACCGCGGGCTTGCGCC CGTGCCAGGCCTCGTATGGCGTCTTGCCGTCGAGGGCCTTGGTGGGGAGC GGTTGAGCAAGTGGACGGCAGTCATCACCGCCTCACCCCAGTAGATCGCC GGCATCCCTCTCTGCTTGAGGAGGGCACGGGCGGTGGCCACCACCGTCTG GTTGCGGCGCTCGACGACGCCGTTCTGCTGCGGAGTGTACGGCGCGGAGA AGTGGCGGTGGATCCCCTCATCGGCGCAGTACGCCACGAACTCGGTCGCC GTGAACTCGCCGCCGTTGTCCATGCGTAGGACTCGAAGCTTGCGGCCGCA CTCCGCCTCCGCAGCAGCTTGAAGACGCTTGATGGCGTCTGCCGCGGCTG CCTTGGCGTCGAGCAGGACAGCCCACATGTAGCGGGACATGTCGTCGATG AGGAGGAAGTAGCGCCGGCCTCCAAGTGTAGCCGGTGTCACGGGGCCACA GAGGTCACCGTGTACGAGCTCTAGCTTCTCCTTGGCGCGGAAGCTTGCCT GGGGAGGGAAAGGGAGCCGCCGCAGCTTGGTGAGGACGCAGGTGTCGCAG AACTGCTCCACGTGGTCGACGTGGGGCATGCCCCGCACCATCTCCTTGCT GCCGAGCTGCCTCAGGGCCTCAAAGTTGAGGTGCCCAAAGCGCTAGTGCC ACCTCCAAGCGTCGTCGTCGCGGCGGGCTGCAAGACAGAGAGGTTGCGCC ACCTACGCGTGAAGGACGTAGAGGCGGTTGCTCCTGTTGACCTTGACCAG GAGCCAGTGTCGATGATCCCAGATGCGCAGCACCCCGTGCTCGATCTCCA CGCGCGATCCGCTCTCATCCAGCTGTCCCAAGTTGATGATGGAGTTCCTC AACGCAGGGATGTAGTAGACACCGGTGAGCAGCCTATGCTCGCCAGTCTT GACGACGAAGACGACAGAGCCGACGCCCTTGATCTCCACAGCGGAGGCGT CGCCGGACTTGACGGTGCCTCGAACGCCTGAGTCGAGCTCGGAGAAGAAC TCCCGCCGCCCGGTCATGTGGTGGGTGGCGCCGGTGTCAAGGCACCACCC GTCGGTCTTGTCGTTGCCGGAGCTGTCGTCGAGGAGGGCGTGTGCTTTTG GCTCGTCAAGGTGGAGGAGAGCCGTTGCGGCCGGTGCCGCTGGAGGTAGT TCGATGCTCGCATGAGCAATGAACAAAGCCGGCTGCTCCTCCTCCGCCTG CGCGACGTGAGCCTGGCCGCGTCGTGGCTGTCGACAATCCTTGGCCCAAT GACCAAGCTTGCCGCAGTTGTAGCAAGGGTCGTCTCGTGCTGGCTTTTGC TTGCCAGCGGCGCCGCCCTGGGCGCCTCCACGATCATCACCCTCGGCACG TTCTCGCGCCCCTGCCTGGGCGTCTTTGCGCGGCTTGCCACGCTTGCGGC CACCTGTCGTGGAAGAAGGCTCCCCCTTCTTCCTGTCACCTTGGCCGGCA GCCCACTGCTCCCGAGTGAGGAGGAGCTTCCCGCCAATGGTGACGGGTCC CGAGAGGCGCTGTGGCTCATCGCTGTCAACGACCTTGAGACGGCCCAACG CCTCCTCGATCGTCATCGTGGAGAGGTCCAGCAGAGACTCGATTGAGCGA GCCATCTGCTTGTACTTCTCGGGGACGCAGCGGAAGAGCTTCTCAACAGC TCTCTCCTCGCCGTAGGTGTCGTCGCCGAACTGCACCAACTTCTGCAACA GAGTGTTGAGACGGAGAGCAAAGTCATCAACGTCCTCACCTGGCTTGAAG GCCAGGTTCTCCCACTCCTTGCGATGTGCCTGCAGTGTGGACTTGCGGGC GCGGTCGCTGCCGATGTGTGCTGCAGCGATGGCGTCCCAGGCCTCCTTGG CAGTTCGCTTACTGGTAAGCGAAAACTGCATCTCGGGCGGGACTGCAGCA ATGAGAGCATCCAGCGCCCGTCGATCTTGGTCGTAGTCGACGTCGCCGTA CCGGACTGCATCCCACATATGCCGCACCTGGAGCCTCACCCTCATCACCG CAGCCCACTCAACGTAGTTGGTCTTGATGAGGGTAGGCCACCCGCCGCCG GGGCCGACGTCCCTGACGACAGCCTGGTGTGACCACGGTACCGAACCGGG GAGAGAGAGTCGCGCTGCCTGTGAAGGCCGCGCTCTCCGTCGACCCGTCC GCCGCCGCCATGCGCGCCTCCTCCAGGAGCGCCACCGCCGTGCGCGCCTC CTTCAGGAGCGCCGCCGGCGTGTCTGCGCCTGTCTGGGCTGCCGCCGCGC TCGTGGGCGTGCGCGGCTGCCCACTGCGCCGCTCGCCCTCGCGATGCCTC CCTCTCCAGCAGCTCGAGGTCCGCGTCGGCGCTGTCATCAGCAGCGATGG AGCTGCTGTTGCTGCCGTGTAGAACCTCGACCTCCGCTGCTGCTGCACGC ACTGCATCCGCCGCCGCTGCTGCTTCCACCTCCGCTCTAGCTGCTGCAGC GGCGTCTGCTGCCGCTCGCTCGCGCTTCTCTACCGCGGTGAGGTCGGCCT CCTGCCGACGCCGCGTGCTCGAGGCGACCGAGCCCTGAGACTGTCCTGCA GACGTGGCGCGCTATCGAGGGGGCTGCTGTGTGGAGAGCAGGGGCAGCCG GAGCTGCTGCTGCTACCGACTAGGGCTGCTGCGAGGCCGGGGAAGGAGAA GAGCAGGAGATGCTCAGGCTACAGGATAGTACGACTCTGATGCCACTTGT TAGTCGCTGGATTCTCACTCTTGGTAGCAGTAGAATCCTTACTCTCATCG AGAGAGGATGACACTAGGAGTTGGGGCAATTTTCTGGTTTATTTCTCACA CAAACCCATACAATGCCATGTCAACCTGAGGGGTTGGGGTTACATACTTA TAGGCTGTTAGCCAGCCAAACATATGCTAAGATGCTAGTCTAAGATGCCA ACTGCTGTCCTAAAAACAGATGCTGTCCTAGATGCTGTCCTAGATGCTAA TTGCTGTCCTAAAAGCAGATGGTGTCCTAGATGCTGTCCTAGATGCTAAC TGCTGTCCTAACAACAGTTAAAAGATGCTGGACACAAAGATCATGTGCTG CGTACTGCAGCAGCCCCACACCCACCAGCCAACACAGAGACTTATCCATC AGAAGCTACTTGCACTTTGCAACTGTTGCAGTGATGCCTCCTACCATTAC CAAGGCCCAACAACCAACATCTCCTCACACTTTATACCCTTCTCTCTTTG TGAAGTAGTTTATGCGCTCTGCTTATTCATATGTAAAAGCAAGTAGAACT GTAGACGATAATAAGATTAAGGTGTAAGCTTTTATAGTACAGGATGTAAT ATTATTACAGTCAGACCTTCATATTTAGTTGTTAAAGTAAGGTTCGGTTG TGCGCAATCATGTTTGCATATAGCAGGGGCGGATGTAGTATAGGTGCATG GGGGTACAGGTACAAGCAGAACACAACAGGCTCCACTTGATCAATTTATT AAGGATAACAAAGAAGCAAGATGCCTGAAGTTCAGGAGGCAGAGATCGGA GAGGCTTTGAAGAGGATGAAGGGAGGTAAAGCGATGGGCCCTGATGGTAT CCCCATTGAGGTGTGGAGATACCTAGGCGCCAAAGCGATAGTATGGTTAA CTAAGCTTTTTAACCTTATTTTTCGGTCTAAAAGATGCCTGAAGAATGGA GGAGAAGTATATTAGTACCTATCTTCAAGAACAAGGGAGATGTTCAAAGT TGTACTAACTACCGTGGGATTAAATTGATGAGCCATACGATGAAGCTCTG GGAGAGGGTTATCGAGCATCGTCTAAGGAGAGTGACATGTGACCCAAAAT CAATTTGGGTTCATGCCTGGTAGGTCGACCATGGAGACGATTTTCTTATT ACGACAATTGATGGAGAGATATAGGGAGCAGAAGAAGGACTTGCACATGG TCTTTATTGACCTCGAGAAGGCATATGACAAAGTACCAAGAAATGTCATG TGGTGGGCCTTGGAAAAGCACAAAGTCCCAACTAAGTACGTTACCCTCAT CAAGGATATGTACAGGGATGTGGTGACGTTTGTCCGAACATGTGATGACG ACACCAGTGACTTTTCAATTAAAATAGGACTGCATCAGGGGTCAGCTTTG AGTCCTTATTTATTTGCTTTGGTGATGGATGAGGTCACAAGGGACATACA AGGTGGTATCCCTTGGTGTATGCTGTTTGCTGATGATGTGGTGCTAGTTG ACGACAGTAGGGCAAGGGTTAATAGGAAGTTAGAACTATGGAGGCAAACG TTAGAATCGAAAGGGTTCAGACTTAGTAGGACTAAGACCGAGTACATGAG GTGCGATTTCAGCGCGACTAGGCATGAGGAGGGAGACGTTAGCCTCGATG GGCAAGTGGTGGCCAAGAAGGATACTTTTCGGTATTTAGGGTCGATGCTA CGAAAGGACGGAGACATTGATGAAGATGTTAGGCATAGAGTTTCAGCCGG CTGGTTGAAATGGCGTCAAGCTTCTGGCGTCCTCTGTGACAAAAGGGTGC CTCAGAAGCTGAAAGGTAAGTTCTATAGGACGGCGATTCGTCCGGCGATG TTATACGGTGCTGAGTGTTGGCCTACAAAAAGGCGACATGTCCAGCAATT GAGTGTAGCAGAGATGCGTATGTTGCGTTGGTGTTGTGGGCACACAAGGA GGGATAGAGTCCGGAACGACGATATTCGGGATAGGGTTGGGGTGGCTCCA ATTGAGGAGAAATTGATTCAACATCGGTTGAGATGGTTTGGACATGTCCA ACGGAGGCCTCCTGAGGCGCCGGTGCGTAGTGGAGTTCTAAAGCGGGCCG ATAATGTAAAGAGCGGTAGAGGTCGACCTAAACTAACTTGGGACGAGTCC GTTAAGAGAGATCTTAAGGAGTGGAATATCTCCAAGGATTTAGCTATGGA TAGGAGCGCTTGGAGATTGGCAATCAACGTGCCTGAACCGTGACCTCTTT TTGTCTTGTGCTCTTTTTGTCCCTTTATGTGTCTTCCTGTTTTCTCGTCT CTTTTGGGTTTCATCTCTAGCCTACCCCAACTTGCTTGGGACAAAATGCT ATGTTGTTGTTGTTGTTGTAACAAAGAAGCAAGAAACTAATATGCATACA GAGACATTGGCAATGACTACCTTTGTATACTTGTGGATAAATGTTTGTGA ATTGTATCCTTATATCTGCACACCTAACTACTTAATGTCATTCAGTCGTC ATATTACATTGTTAGCGAATTGCATCGTTTAGGTCCATTCCCCCATGATT GAAATCCTGTATCTGCTGCCACTGGGCCACTGGCATATGGCCATAATCAT ATCATAGGTGTTTCCATTTTCCTATATCAGCTACCACAGTGCTTATTCTG TACCCTTCTCAATGGATCCCACTAGTTGGCACTCCATCTGAGCTGGTAGT GAATGTCTGTTGGAAAGTGAGAATCTAGCATTTTTCTTATGGACCCCACC AGTTAACATATCTTTGCAATAGAGAGAAAAGTTCTGTCAATCTTTGCTTA AATCAGTTTCACAAGATGTGCAACGATTTGGCTTATCCTGTGATGTTATG TTTTCTTTTCTTATTATTATTAGAGGGAGAGAGGTGACGATTGGCGAATG GAGGATCTAGATGCAAAGGTTTGTCGCATGTCTGTAATATGTACATGAAA GGTGGTGGATTTTGATTGGAATTTTCTAGGGCATAGCATATCAGGTATTC CTATCCAATTTCCTTTGCTTTGTGTGTCAAATGGAAAACATCAATAAAAT TGTAAAAAAGGCAGATTTTTAATGTAAATGAGCATTCTCTTTGAACTTGA ACCTCATTTGCTGTTAAGGGGGAGGGGTGGGTCTATTGCGCACTCCCTCC ATCCCAAATTATAAGATGTTTTGGCTTTTCAAGATACGTAGATTTTGCTT GCACTTAGATATACACTGATAGTGTTAGTCTTTTCCAGCTATATATTTCT TTCTTTCAACGTAGTTCAATTATCCTTTTCTTTTAAGTTCTTGTAAAGTT CT
back to top

Coding sequence (CDS) from alignment at Sh_012J22:30475..45276-

>Sh_012J22_t000020 ID=Sh_012J22_t000020|Name=Sh_012J22_t000020|organism=R570 Sugarcane cultivar|type=CDS|length=666bp|location=Sequence derived from alignment at Sh_012J22:30475..45276- (R570 Sugarcane cultivar)
ATGTGGCCCGCGCCTCGGCCCAGCCACTCGAGGTCTGCGCTAAGGAGTCC
ATCACCGTCCCTGGCCGCCTCGGAGACTTGTTTTGGTCCTTTCACACAGA
GGGTTTTGTTGACTATAGAGGAGAAGCATCTGCCTTATGAACTGAAGCTA
GTTGATCTAGCTAATAAGCCGGATTGGTTATTTGAAATCAACCCAGAAGG
TAAAGTGCCTATCGTGAAGTTTGAGGAAAAATGGATTGGTGATTCTGATG
TTATAACACAAACATTAGAGGAGAAGTATCCTGAACCACCCTTGGCAACT
CCACCAGAAAAAGCTTCAGTTGGGTCAAAAATATTTTCCACTTTCATTGG
TTTCCTCAAAAGCAAAGATCCAAGTGATGGAACAGAAGAGGCACTACTTA
ATGAGCTTACTTCATTTGATAGTTATCTAAAAGACAATGGTCCATTTATT
AATTGTGGAACAATTTCTGCTGCTGATCTCTCTCTGGGCCCTAAACTATA
TCACATGGAGATAGCCCTGGGTCACTATAAGAACTGGTCTGTTCCAGATT
CACTTTCTCATGTAAAAACATACATGAAGTCGATTTTCTCAACGGATTCT
TTTGTCAAAACTCAAGCTCTGCCAGAGGATGTAATTGCTGGATGGCGCCC
AAAAGTCATGGGTTAA
back to top