Sh_012P16_p000030

Overview
NameSh_012P16_p000030
Unique NameSh_012P16_p000030
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length499
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_012P16contigSh_012P16:33917..37997
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
EC1.2.1.9
EC1.2.1.73
EC1.2.1.90
InterProIPR016162
InterProIPR029510
InterProIPR016160
InterProIPR016161
InterProIPR015590
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_012P16_t000030Sh_012P16_t000030R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_012P16_p000030 ID=Sh_012P16_p000030|Name=Sh_012P16_p000030|organism=R570 Sugarcane cultivar|type=polypeptide|length=499bp
MALAGTGVFAEILDGEVYRYYADGEWRSSASGKSVAIVNPTTRKTQYRVQ
ACTQEEVNKAMDAAKVAQKAWARTPLWKRAELLHKAAAILKEHKTPIAEC
LVKEIAKPAKDAISEVVRSGDLVSYTAEEGVRILGEGKLLVSDSFPGNER
NKYCLSSKIPLGVVLAIPPFNYPVNLAVSKIGPALIAGNALVLKPPTQGA
VAALHMVHCFHLAGFPKGLISCVTGKGSEIGDFLTMHPGVNCISFTGGDT
GIAISKKAGMVPLQMELGGKDACIVLEDADLDLVAGNIVKGGFSYSGQRC
TAVKVVLIMESVADAVVQKVNAKLAKLKVGPPEDDSDITPVVTESSANFI
EGLVMDAKEKGATFCQEYRREGNLIWPLLLDHVRPDMRIAWEEPFGPVLP
VIRINSVEEGIHHCNASNFGLQGCIFTRDINKAILISDAMETGTVQINSA
PARGPDHFPFQGLKDSGIGSQGITNSINMMTKVKSTVINLPSPSYTMG*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0016491oxidoreductase activity
Vocabulary: Biological Process
TermDefinition
GO:0008152metabolic process
GO:0055114oxidation-reduction process