Sh_012P16_p000080

Overview
NameSh_012P16_p000080
Unique NameSh_012P16_p000080
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length231
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_012P16contigSh_012P16:80886..87362
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
EC2.7.1.24
InterProIPR027417
InterProIPR001977
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_012P16_t000080Sh_012P16_t000080R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_012P16_p000080 ID=Sh_012P16_p000080|Name=Sh_012P16_p000080|organism=R570 Sugarcane cultivar|type=polypeptide|length=231bp
MRLVGLTGGIASGKSTVSNLFRDSGVPVVDADVVARDVVQKGTRGWKKIV
KAFGNDILLESGEINRALLGQIVFSDPSKRQLLNRLLAPHISSGIVWEIA
KLWMEGCKVIILDIPLLFETKMDRWTNPVIVIWVDPKVQIERLISRDGCS
EEQAQNRINAQLALDWKKSEADIVIDNSGSLDDTKEKFQEVLRKVSEPLT
WRERLRSRDGLISVVVCTAVGILLAQKNLL*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0004140dephospho-CoA kinase activity
GO:0005524ATP binding
Vocabulary: Biological Process
TermDefinition
GO:0015937coenzyme A biosynthetic process