Sh_013E15_p000060

Overview
NameSh_013E15_p000060
Unique NameSh_013E15_p000060
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length280
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_013E15contigSh_013E15:74166..78992
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR002100
InterProIPR002487
InterProIPR033896
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_013E15_t000060Sh_013E15_t000060R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_013E15_p000060 ID=Sh_013E15_p000060|Name=Sh_013E15_p000060|organism=R570 Sugarcane cultivar|type=polypeptide|length=280bp
MGRGRIEIKRIENNTSRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSS
RGRLYEYSNNRCVRCTADLASRQLATIERYKKAHTVGSSSGPPLLEHNAQ
QFYQQESAKLRNQIQMLQNTNRHLVGDSVGNLSLKELKQLESRLEKGISK
VRARKNELLAAEINYMAKRETELQNDHMNLRTMIEEGEQQLQQVTVARSV
AAAAATNVELNPFLEMDTKCFFPGGPFATLDMKCFFPGSFQMLEAAAAQQ
RQMLATELNLGYQLAPPGSDAANNNPHQF*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0003677DNA binding
GO:0046983protein dimerization activity
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0000977RNA polymerase II regulatory region sequence-specific DNA binding
Vocabulary: Biological Process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0045944positive regulation of transcription from RNA polymerase II promoter
Vocabulary: Cellular Component
TermDefinition
GO:0005634nucleus