Sh_013E15_t000050

Overview
NameSh_013E15_t000050
Unique NameSh_013E15_t000050
TypemRNA
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length573
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_013E15contigSh_013E15:64111..64759
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Properties
Property NameValue
NoteConserved hypothetical protein
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
Sh_013E15_g000050Sh_013E15_g000050R570 Sugarcane cultivargene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Sh_013E15_p000050Sh_013E15_p000050R570 Sugarcane cultivarpolypeptide


Sequences
The following sequences are available for this feature:

mRNA sequence

>Sh_013E15_t000050 ID=Sh_013E15_t000050|Name=Sh_013E15_t000050|organism=R570 Sugarcane cultivar|type=mRNA|length=573bp
ATGGAGAGGGCCACGGAGTTGTATTACGGAACGAGAGATTTTGAAAAAGC
CACGGTCGCATACAAGTATTCAAGAGGCAAACCTTTGGTCGCCACCAAAC
AAGAGTATAGAGATTTGCCAACATACATGCGACAGTTGCATGATTATTAC
TCCCTGGATACTGCCAACGGAGACTGTGTCGGTTTTGAAGTTTGCATCCC
TCCCGAAATGGTTTTTAATCATCCTGAAGAAACGGTGCATATTATTTATT
ATGAACACCTCTTTCAGCTCTTCCAACGGCGCTCGCTCGATACGCAGATT
TTGATGATATGGTCTATGTGTATGGCAAAATGGTGCCTAAAGAAGCAATT
GAGCAATATAGACTTCTTGGATCCCATATTTGTAAATGAGACAACATGCA
CCGCCTCTGGTGAAGATGACTATGTACCAACAAGTTTGAAGATTGAGTTT
GAAAGGATGTTCAGAAACAACAAAACAAACGTACTCCTACCCTACAACTG
CGAGTATGTGTTCTCGACCCTTATTTTAGTGTTTCTTTTCTTGATATGTC
ATTCAATAACATGGACTTTGTGA
back to top

protein sequence of Sh_013E15_p000050

>Sh_013E15_p000050 ID=Sh_013E15_p000050|Name=Sh_013E15_p000050|organism=R570 Sugarcane cultivar|type=polypeptide|length=191bp
MERATELYYGTRDFEKATVAYKYSRGKPLVATKQEYRDLPTYMRQLHDYY
SLDTANGDCVGFEVCIPPEMVFNHPEETVHIIYYEHLFQLFQRRSLDTQI
LMIWSMCMAKWCLKKQLSNIDFLDPIFVNETTCTASGEDDYVPTSLKIEF
ERMFRNNKTNVLLPYNCEYVFSTLILVFLFLICHSITWTL*
back to top

mRNA from alignment at Sh_013E15:64111..64759-

Legend: polypeptideexonCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>Sh_013E15_t000050 ID=Sh_013E15_t000050|Name=Sh_013E15_t000050|organism=R570 Sugarcane cultivar|type=mRNA|length=649bp|location=Sequence derived from alignment at Sh_013E15:64111..64759- (R570 Sugarcane cultivar)
ATGGAGAGGGCCACGGAGTTGTATTACGGAACGAGAGATTTTGAAAAAGC CACGGTCGCATACAAGTATTCAAGAGGCAAACCTTTGGTCGCCACCAAAC AAGAGTATAGAGATTTGCCAACATACATGCGACAGTTGCATGATTATTAC TCCCTGGATACTGCCAACGGAGACTGTGTCGGTTTTGAAGTTTGCATCCC TCCCGAAATGGTTTTTAATCATCCTGAAGAAACGGTGCATATTATTTATT ATGAACACCTCTTTCAGCTCTTCCAACGGCGCTCGCTCGATACGCAGATT TTGATGATATGGTCTATGTAAGTACCCTACCCTCACAACGTTATAATAAA CTACGTGATTTGCATTTGAATATATCATATGTTTATTATGCAGGTGTATG GCAAAATGGTGCCTAAAGAAGCAATTGAGCAATATAGACTTCTTGGATCC CATATTTGTAAATGAGACAACATGCACCGCCTCTGGTGAAGATGACTATG TACCAACAAGTTTGAAGATTGAGTTTGAAAGGATGTTCAGAAACAACAAA ACAAACGTACTCCTACCCTACAACTGCGAGTATGTGTTCTCGACCCTTAT TTTAGTGTTTCTTTTCTTGATATGTCATTCAATAACATGGACTTTGTGA
back to top

Coding sequence (CDS) from alignment at Sh_013E15:64111..64759-

>Sh_013E15_t000050 ID=Sh_013E15_t000050|Name=Sh_013E15_t000050|organism=R570 Sugarcane cultivar|type=CDS|length=573bp|location=Sequence derived from alignment at Sh_013E15:64111..64759- (R570 Sugarcane cultivar)
ATGGAGAGGGCCACGGAGTTGTATTACGGAACGAGAGATTTTGAAAAAGC
CACGGTCGCATACAAGTATTCAAGAGGCAAACCTTTGGTCGCCACCAAAC
AAGAGTATAGAGATTTGCCAACATACATGCGACAGTTGCATGATTATTAC
TCCCTGGATACTGCCAACGGAGACTGTGTCGGTTTTGAAGTTTGCATCCC
TCCCGAAATGGTTTTTAATCATCCTGAAGAAACGGTGCATATTATTTATT
ATGAACACCTCTTTCAGCTCTTCCAACGGCGCTCGCTCGATACGCAGATT
TTGATGATATGGTCTATGTGTATGGCAAAATGGTGCCTAAAGAAGCAATT
GAGCAATATAGACTTCTTGGATCCCATATTTGTAAATGAGACAACATGCA
CCGCCTCTGGTGAAGATGACTATGTACCAACAAGTTTGAAGATTGAGTTT
GAAAGGATGTTCAGAAACAACAAAACAAACGTACTCCTACCCTACAACTG
CGAGTATGTGTTCTCGACCCTTATTTTAGTGTTTCTTTTCTTGATATGTC
ATTCAATAACATGGACTTTGTGA
back to top