Sh_013G21_p000050

Overview
NameSh_013G21_p000050
Unique NameSh_013G21_p000050
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length1855
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_013G21contigSh_013G21:46039..74098
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR018501
InterProIPR011989
InterProIPR001356
InterProIPR007759
InterProIPR028941
InterProIPR028942
InterProIPR009057
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_013G21_t000050Sh_013G21_t000050R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_013G21_p000050 ID=Sh_013G21_p000050|Name=Sh_013G21_p000050|organism=R570 Sugarcane cultivar|type=polypeptide|length=1855bp
MDAGGDGDGDGAGKAALEAPAEATTPPPAPVAAPVPVSASAAAAGAGTSG
SGEKPVKRMMKTPYQLEVLEKTYAVEQYPSEAMRLELSAKIGLSDRQLQM
WFCHRRLKDRKPPSKRQRREEESALAPVMPPPPVLPAPVSVMPLASSDLM
VGAPGPYDEPVHPVHSRRGAGRSSAVPRISMPDIGRRYYEPPPIMITPAI
PSMQLTQSELRVINSVESQLGEPLREDGPALGVEFDPLPPGAFGAPIVPE
QQKQPVRSYDTKIFSRHDQKLLKASAFLPTMESPFVPNSFTGKRKSMVGN
SPIVQPHVGSRAVHEYQFLPEQPSDTYERASRSHYYDTPVEVSNSRISSL
TSGSQLLHGSEAAVPSYAFQGHTSGSSLLPQSSRSQVFPAAPADYETTQT
NSNLNSVPVEGQFDISQVAAFENPLVSSERRAYHDEDTSRVERKRKHNEE
AKIAKEVEAHERRIRKELEKQDILNRKREEQRRKEMERLDRERRKEEERL
LRERQREEERFQREQRREHERMEKFLQKQSRRAEKQRQKEELRKEKEAAR
QKAANERATARRIAREYMELVEDERLELMELAAQNKGLPSMLYLDSDTLQ
QLDSFRGMLSQFPPTTVRLKLPFSIKPWTGSEDNVGKLLMVWKFFITFTD
VLGLCPVTLDEFVQSLHDYDSRLLGELHVALLKSIIKDIEDVARNPSIAL
GVNPGGHPQIVEGAYAWGFNIRGWQRHLNLLTWPEILRQFALSAGLGPQL
KKRTVEDSYYRNDNEGHDGENVISTLRNGSAAVNAAAKMKERGYTNRRRS
RHRLTPGTVKFAAFHVLSLEGSKGLTILEVAEKIQKSGLRDLTTSKTPEA
SIAAALSRDAKLFERTAPSTYCVKSPYRKDPADSEAVLSAAREKIRAFQN
VLSDSEAEKEADEAERDDDSECDDADDDPDGDDVNTEVEDDKDPLLAVKA
QDEVPSTTTVIGIRSELDSVGNALNSSSSFTKSAKGTPLPSLGKSNAADT
SNDSPLGGSSANHEVAPGDSENTHIDESNQVEPWVRALAEGDYCDLSVEE
RLNALVALVGVATEGNSIRGVLEERLELANALKKQMWAEAQLDKRRSKEE
FASRIQYNSDMGLKADIYQENNATEITSTPACDVYKENDGHVGTINSCEM
LDQHNQGNSASMAYERNGIGQEILATPDTSYVQQYAYADKTRSQLKSYIG
HRAEQLYVYRSLPLGQDRRRNRYWQFTTSASPNDPGSGRIFFESKDGCWR
VIDSEEAFDSLVAALDTRGSREAQLHSMLQVIEPIFKEAIKRRSASIELS
AGRYPKNGATDMIRANYHSEVGSSSSTPFGATSDSVTAYSDSFKVELGRN
DFEKTAISKRADKFLKWMWRECYNQELTCAMKYGKKRCSELLHSCNCCYQ
IYLAEERHCPSCHKTFKSIYNFSDHTTQCEEKRRTDPYWKMQIADYSVPI
GMVLLKLQLVTIEASIPSEALQPFWTDVYRKTWSVKLYTTKSIAETFQLL
TVLEGAIRPGCLSSDFETTSECLNSQGIAPQNPVLPAGSASVLPWVPDTT
SAVMLRMLDLDSAISYVQNQKMERDDGGFMKFPSRYTVAKSKQEGILEPT
GLNLYDGRWLPGSGRRGCGRGSRGGSRGGRGRSRGGRIPRGVSSSSRIEF
KDDIVASDKAPRKNARRGRARGRGSRRGRRTVRPRQPSAGRARSIPKENL
LGSFSMLSSSKPAPVEESPQSSGADEWGLETRVTYNECDDNSSGSQSEDN
GENGQPMDEDYEEQVPDYSMGYSSGSRHHGMMSMMDHETDEEDEDVEGDE
NVEEDDADQAVDDADVEMDEDDEIGDDGEDGDVGGEMNADEDPDATSYSS
DYSE*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0003677DNA binding
Vocabulary: Biological Process
TermDefinition
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated