Sh_013M22_p000010

Overview
NameSh_013M22_p000010
Unique NameSh_013M22_p000010
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length547
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_013M22contigSh_013M22:1..3613
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR017441
InterProIPR000719
InterProIPR011009
InterProIPR008271
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_013M22_t000010Sh_013M22_t000010R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_013M22_p000010 ID=Sh_013M22_p000010|Name=Sh_013M22_p000010|organism=R570 Sugarcane cultivar|type=polypeptide|length=547bp
MPELRSSTRQARLRSKKLDDLQPGEPPAKPVPPAPQRAAKRAPTRAARGR
KGAAGRGAPPAPKPRRKGVEIADLEADPACEDPPKAVKGLEVAAAAPKNL
LLKKVAKVGVPKMDGESPEKIVGAEDESTATPVPERVHVGNSPEYITDRK
LGKGGFGQVYVGRRVSGGNARTGPDAYEVALKFEHRNSKGCNYGPPYEWQ
VYNTLNGCYGIPSVHYKGRQGDYYILVMDMLGPSLWDVWNSMGQTMSANM
AACIAVEGISILEKLHSKGFVHGDVKPENFLLGQPGSPDDKKLYLIDLGL
ASKWRENNGHHVDYDQRPDIFRGTIRYASVHAHLGRTGSRRDDLESLAYT
LIFLIRGRLPWQGYQGDTKSFLVCKKKMATSPEMLCCFCPAPFKQFLEIV
TNMKFDEEPNYAKLISLFDGLIEAPASRPIRIDGAVKVGQKRGRLLANLE
EDEQPKKKVRLGSPATQWISVYNARRPMKQRYHYNVADSRLSQHIEKGND
DGLYISCVASSANLWALIMDAGTGFCSQVYELSPVFLHKVQYHLSQA
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0005524ATP binding
GO:0004672protein kinase activity
Vocabulary: Biological Process
TermDefinition
GO:0006468protein phosphorylation