Sh_013M22_p000020

Overview
NameSh_013M22_p000020
Unique NameSh_013M22_p000020
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length208
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_013M22contigSh_013M22:18556..20087
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR000439
InterProIPR012678
InterProIPR024794
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_013M22_t000020Sh_013M22_t000020R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_013M22_p000020 ID=Sh_013M22_p000020|Name=Sh_013M22_p000020|organism=R570 Sugarcane cultivar|type=polypeptide|length=208bp
MRFVQRVRCWEYRQQPAIVRLTRPTRPDKARRLGYKAKQVDLPAWRPVLL
TAASLSSYCQGYVVYRVRVRRGGRKRPVPKGIVYGKPKHQGITQLKFQRN
KRSVAEERAGRKLGGLRVLNSYWVNEDSTYKYFEIILVDVAHTAIKTDPR
INWLCNPVHKHRELRGLTSAGKKFRGLRGKGHTHHKNRPSRRATWKRNQT
LSLRRYR*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0003735structural constituent of ribosome
Vocabulary: Biological Process
TermDefinition
GO:0006412translation
Vocabulary: Cellular Component
TermDefinition
GO:0005840ribosome
GO:0005622intracellular