Sh_013M22_p000030

Overview
NameSh_013M22_p000030
Unique NameSh_013M22_p000030
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length359
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_013M22contigSh_013M22:22820..26263
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
EC2.7.7.5
InterProIPR011146
InterProIPR001937
InterProIPR005849
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_013M22_t000030Sh_013M22_t000030R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_013M22_p000030 ID=Sh_013M22_p000030|Name=Sh_013M22_p000030|organism=R570 Sugarcane cultivar|type=polypeptide|length=359bp
MATAEASRTSEARRDAVFGRWVVFSPARSRRPTDLKSHSPANPSPAGPAG
ADAPEPPKPSCPFCAGRESECAPQIFRVPTDGTAPWRIRVIQNLYPALRR
DVEPPPPVLPEGEAPPDEPGERAVPGFGFHDVVIETPRHDVRLWDLDAEG
VRDVLLAYAERVRQLGEHPVVKYVQVFKNHGASAGASMAHSHSQMLGTPF
VPPSVTTRLNCMKEIFDRSGNCSLCEIRSKDILISETPNFSAIVPFAASY
PFEIWIIPRQHISYFHKIDQDKALDLGSLLKTMLQKLSKQLNDPPFNFMI
HSAPFGLSSSCLPYTHWFLQIVPQLSVVGGFELGSGCYINPVFPEDAAKI
LRELDCSV*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0003824catalytic activity
GO:0008108UDP-glucose:hexose-1-phosphate uridylyltransferase activity
GO:0008270zinc ion binding
Vocabulary: Biological Process
TermDefinition
GO:0033499galactose catabolic process via UDP-galactose
GO:0006012galactose metabolic process