Sh_013M22_p000040

Overview
NameSh_013M22_p000040
Unique NameSh_013M22_p000040
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length343
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_013M22contigSh_013M22:27282..28889
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR001478
InterProIPR013026
InterProIPR019734
InterProIPR011990
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_013M22_t000040Sh_013M22_t000040R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_013M22_p000040 ID=Sh_013M22_p000040|Name=Sh_013M22_p000040|organism=R570 Sugarcane cultivar|type=polypeptide|length=343bp
MALASQVAANQPPLLSSPARRLSRASSSNALLLLQPAAAVLGGRNLRLAP
TAGARRAQLDAVVVRASSEAKAAAETKSSGGGGEGAEEEERPYEEYEVTI
QKPYGLKFTKGRDGGTYIEAILPGGVADVTGQFEVGDKVLATSAVFGEEI
WPAKGYGQTMYSIRQRVGPLYLKMERRFGKVDGDGDLTEKEIIRFERNSG
VVSGRVREIQLQNYTRKMEQKMQREEDLRMGLRLYKDGKYEEALEKFESV
LGSKPEPSEASIASYNVACSYSKLGRIEAGLSALEEALKAGYEDFKRVRT
DPDLANLRKSEEFEPLLKNYDESFINENAINAIKSLFGLIKN*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding