Sh_013O24_p000050

Overview
NameSh_013O24_p000050
Unique NameSh_013O24_p000050
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length337
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_013O24contigSh_013O24:77179..78189
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR000719
InterProIPR011009
InterProIPR017441
InterProIPR008271
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_013O24_t000050Sh_013O24_t000050R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_013O24_p000050 ID=Sh_013O24_p000050|Name=Sh_013O24_p000050|organism=R570 Sugarcane cultivar|type=polypeptide|length=337bp
MVTVTTAASCYCWAIKKRELGRKRAELFRKNGGLLLQERFSTIASQGEDQ
YSAKIFSAEELKAATDNYSESRILGRGGHGTVYKGILPDQTIVAIKKSKV
FDESQVEQFVNEIAILSQIDHPNVVKLLGCCLETQVPLLVYELIPNGTLF
QHIHNRNATRPLTWEDCLRIAAETADALAYLHSRSSVPIIHRDIKSSNIL
LDENFVAKIADFGASRSVPFDQTHITTLFQGTIGYLDPEYFQTSQLTEKS
DVYSFGVILAELLTRQKPISAARPEESCNLAMHLVVLFNEGRLLQEVEPH
ILAEAGKDQCYADNRTDQIIRVQVQKQVPKRSNFRT*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
Vocabulary: Biological Process
TermDefinition
GO:0006468protein phosphorylation