Sh_013P09_p000010

Overview
NameSh_013P09_p000010
Unique NameSh_013P09_p000010
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length340
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_013P09contigSh_013P09:282..7697
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
EC3.4.17.10
EC3.4.17.12
EC3.4.17.22
EC3.4.17.3
InterProIPR000834
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_013P09_t000010Sh_013P09_t000010R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_013P09_p000010 ID=Sh_013P09_p000010|Name=Sh_013P09_p000010|organism=R570 Sugarcane cultivar|type=polypeptide|length=340bp
MAISHLQPVVILLVLRAFASLPTQAAARGGHDPSGDGAHESLSRKLLEDK
PPQITEEMVRGYMSNAELEAAVHAFGSRCSNISRVYSVGKSVNHFPLWVI
EISDKPRQREAEPAFKFIGNVHGDEPVGREVLMHLANWLCDNYLKDSLAT
LIVENIHLHILPTMNPDGFALRWRGNANNIDLNRDFPDQPETRAIMNWVK
QEHFTASASLHGGALVANYPWDGTRDTSKHYYGCPDDKTFRHMASVYSRS
HYNMSLSKEFEGGITNGAFWYPIYGGMQDWNYIHGGCFELTLEISDTKWP
KADELPVIWEHNRMSMLNLLASLIKVICFHSSPFIHCKG*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0004181metallocarboxypeptidase activity
GO:0008270zinc ion binding
Vocabulary: Biological Process
TermDefinition
GO:0006508proteolysis