Sh_013P09_p000020

Overview
NameSh_013P09_p000020
Unique NameSh_013P09_p000020
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length666
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_013P09contigSh_013P09:10890..16119
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR006297
InterProIPR009022
InterProIPR013842
InterProIPR000795
InterProIPR031157
InterProIPR000640
InterProIPR027417
InterProIPR005225
InterProIPR009000
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_013P09_t000020Sh_013P09_t000020R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_013P09_p000020 ID=Sh_013P09_p000020|Name=Sh_013P09_p000020|organism=R570 Sugarcane cultivar|type=polypeptide|length=666bp
MAGAAVLRRSARRISRHLAAAPAFSRSALQQPERLLSSQSSPEHGARGAV
SGSELALYPPERVRNFSIIAHVDHGKSTLADRLLELTGTIQKGHGQPQYL
DKLQVERERGITVKAQTATMFYRHVTASQDSDMPKYLLNLIDTPGHVDFS
YEVSRSLAACQGALLVVDAAQGVQAQTIANFYLAFESNLSIIPVINKIDQ
PTADPDNVKDQLKRLFDIDPSEALLTSAKTGKGLEQVLPAVIERIPSPPG
KCDAPVRMLLLDSYYDEYKGVICHVAIVDGALRKGDKIASAATGRAYEVL
DVGIMHPELTPTGVLYTGQVGYVISGMRSTKEARIGDTLHQAKSTVKPLP
GFKPAKHMVFSGLYPADGSDFEALSHAIEKLTCNDASVSVTKETSNALGM
GFRCGFLGLLHMDVFHQRLEQEYGAQVISTIPTVPYIFEYGDGSKVQVEN
PAALALNPGKRVAACWEPTVIATIIIPSEYVGPVIMLCSERRGEQLEYTF
IDAQRALLKYRLPLKEIIVDFYNELKGITSGYATFDYEDSEYQQSDLVKL
DILLNGQPVDAMATIVHNQKAQRVGKELVEKLKKFIERQMFEITIQAAIG
SKVIARETLSAMRKNVLAKCYGGDITRKKKLLEKQKEGKKRMKRVGSVDI
PQEAFHELLKVSNSK*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0005525GTP binding
GO:0003924GTPase activity