Sh_013P09_p000040

Overview
NameSh_013P09_p000040
Unique NameSh_013P09_p000040
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length327
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_013P09contigSh_013P09:19693..20673
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR012334
InterProIPR002022
InterProIPR011050
InterProIPR018082
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_013P09_t000040Sh_013P09_t000040R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_013P09_p000040 ID=Sh_013P09_p000040|Name=Sh_013P09_p000040|organism=R570 Sugarcane cultivar|type=polypeptide|length=327bp
MGFGHRATGGLAGRIYVVTDPRDDPANLVIPRKGTLRYAVIQDRPLWITF
ARDMVINLCRELIVSSDKTIDGRGAQVHITGAQITLQNVHNVILHNLHIH
DAVPRGGGVIRDSKHHSGVRGESDGDGISVMGSSDIWIDHVSMRSCADGL
VDVVDGSTAVTISNGHFTKHDHVMLFGASDSAVKDKLMQVTVAFNHFGKG
LVQRMPRCRYGFFHVVNNDYTHWLMYAIGGSQNPTIISQGNRFRAVDDRN
FKEVTKREYTPYSQYKDWVWKSQDDLFLNGAFFNQSGGQNERRFDRLDLI
QAKGGQYAESLTRYAGALNCRVGKKC*
back to top