Sh_013P09_p000070

Overview
NameSh_013P09_p000070
Unique NameSh_013P09_p000070
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length440
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_013P09contigSh_013P09:40003..41322
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR002022
InterProIPR012334
InterProIPR011050
InterProIPR018082
InterProIPR007524
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_013P09_t000070Sh_013P09_t000070R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_013P09_p000070 ID=Sh_013P09_p000070|Name=Sh_013P09_p000070|organism=R570 Sugarcane cultivar|type=polypeptide|length=440bp
MAAVMIMSRRPLSVLFYVVLAAVAAAAQASNNNNVTSDEEYWAERAEAAC
SRNRAAYVSDPVAAMNRFNVDVLRATTRRALARYNGPCMATNPIDRCWRC
RADWATDRKRLAQCARGFGHRTVGGAAGKLYVVRDPSDDEMIIPRKGTLR
HAVIQDRPLWIVFARDMVIRLRQELMVSSNKTIDGRGAQVHIVHAQITLQ
NVHDVILHNLHIHDAKAHSGGMIRDSKRHTGLRTRSDGDGISVLSSSNVW
IDHVSMSSCADGLIDVVNGSTAITVSNSHFTRHDHVMLFGASNDNPQDEV
MQITVAFNHFGRGLVQRMPRCRYGFFHVVNNDYTHWLMYAIGGNKNPTII
SQGNRFIAPDDPNAKEVTKREYTPYKDYKEWVWKSQGDVMMNGAFFNESG
GQNERKYDKFDFIPAKHGRYVGQLTRFAGPLKCIVGQPC*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0030570pectate lyase activity