Sh_013P09_p000100

Overview
NameSh_013P09_p000100
Unique NameSh_013P09_p000100
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length145
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_013P09contigSh_013P09:59450..59884
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR018104
InterProIPR001253
InterProIPR006196
InterProIPR012340
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_013P09_t000100Sh_013P09_t000100R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_013P09_p000100 ID=Sh_013P09_p000100|Name=Sh_013P09_p000100|organism=R570 Sugarcane cultivar|type=polypeptide|length=145bp
MPKNKGKGGKNRKRGKNEADDDKRELVFKEDGQEYAQVTRMLGNGRCEAI
CVDGTRRLCHIRGKMHKKVWIAAGDIVLVGLRDYQDDKADVILKYMNDEA
RLLKAYGELPETLRLNEGVDVDGPEDGEEGSDYIQFEDEDIDKI*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0003743translation initiation factor activity
GO:0003723RNA binding
Vocabulary: Biological Process
TermDefinition
GO:0006413translational initiation