Sh_013P09_p000120

Overview
NameSh_013P09_p000120
Unique NameSh_013P09_p000120
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length147
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_013P09contigSh_013P09:64360..64800
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR003480
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_013P09_t000120Sh_013P09_t000120R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_013P09_p000120 ID=Sh_013P09_p000120|Name=Sh_013P09_p000120|organism=R570 Sugarcane cultivar|type=polypeptide|length=147bp
MRRLASDAEHDAEAYAKLVPTLVVSALPARALVVQVTRPADADDGGGFGA
VVVGVSMCHGVGDGQALWEFIRAWAAAARGGSPALPGFLLPVFDRAVINS
HPKAEAVSRTFLRIFAPALPMVSCSVNSACLTASVAVPSYISFFFH*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0016747transferase activity, transferring acyl groups other than amino-acyl groups