Sh_013P09_p000140

Overview
NameSh_013P09_p000140
Unique NameSh_013P09_p000140
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length341
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_013P09contigSh_013P09:68289..69311
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR003480
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_013P09_t000140Sh_013P09_t000140R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_013P09_p000140 ID=Sh_013P09_p000140|Name=Sh_013P09_p000140|organism=R570 Sugarcane cultivar|type=polypeptide|length=341bp
MRSRVRILAVTHVLPAPDHQTAIWSPEAVSDDGHVKLSFMDALFVDRVPM
QRLFFYEGPDVPPFQSLVRSLKSSLAAVLPIFQPLAGKLTHCASTGDVVV
DCSPAAVSPGVRFVEAEYAGSIDDMGRLAVGDEHHTEALTLLGPELNAGR
LPAPVLAVQVTRPAIGAGLAGVVVGVSIHHAVADGHSVWQFMRAWSAASR
RDPASDMVTPPPTWDRTAIPYPKAEEVARKFLRTVAPALPVARSPSLYTP
LEQRRRSFLLRADDIRSLKQSILTKSQAIGGHLGTFPSTYVAVLSLVWTS
IVRAKSLNDPDGGDAYFLVPVDLRRRLGPAPAVDERYFGN*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0016747transferase activity, transferring acyl groups other than amino-acyl groups