Sh_014A20_p000010

Overview
NameSh_014A20_p000010
Unique NameSh_014A20_p000010
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length1327
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_014A20contigSh_014A20:34121..74133
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR004871
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_014A20_t000010Sh_014A20_t000010R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_014A20_p000010 ID=Sh_014A20_p000010|Name=Sh_014A20_p000010|organism=R570 Sugarcane cultivar|type=polypeptide|length=1327bp
MSYAAYKMMHWPTGIDHCAAGFITHSPADAAAFSSPAPAAAASGPDGDID
SAAARAPRRVGPTPNLVVSAANVLEVYAVRADDATGAEDVGNSSSTGAIL
DGISGARLELVCHYRLHGNIESMAVLSDSTENRRDSIAVTFKDAKIACME
FDDSTNGLRTSSMHCFEGPEWFHLKRGRESFAWGPIIKADPQGRCGAVLV
YGLQMIILKAAQVGQSLVGEDEPTRVLSSTAVRIESSYVIDLRDLEMNHI
KDFTFVHGYIEPVLVILHEREPTWAGRISSKSQTCMLSAFSISMGLKQHP
MIWSAAKLPHDAYQLLAVPPPISGILVICANSIHYHSQSTSCSLALNSFS
SQPDGSPEILKTSFHVELDVAKATWLSHDIVMFSSKNGEILLLTVVYDGR
AVQRLDLMKSKASVLSSGATTLGSSFFFLGSRLADSLLVQFSCGMPASVL
PDLTDESADIEGDLPFSKRLKRIPSDVLQDVTSVEELSFHNKTVPNIVDS
AQKISFVVRDALINVGPLKDFAYGLRTNSDPNATGIAKQSNYELVCCSGH
GKNGTLSALQQSIRPDLITEVELPSCTGIWTVYYKSSRGNTADNNEYHAY
LIISLESRTMVLQTGDDLGEVTETVDYNVQASTIAAGNLFGRRRVIQVYA
KGARVLDGSFMTQELNFSMHTSESSSSSEPLAAASASIADPYVLLKMGDG
SIRLLIGDHSTCTISINAPAIFASSSERISSCTLYCDRGPEPWLRKTRTD
AWISTGIGEATDVNDNSSHDLSDIYCIICYESGKLEIFEVPSFKCVFSVD
NFVSGPAILFDAFSHISTKGSGIGDRDATKVSVKKEEATNIKIVELAMHR
WSGQFSRPFLFGLLNDGTLLCYHAYYYESSESNVQCSPFSPHGSPDIGNA
TDSRLRNLRFCRVSIDISSRNDISCLVRPRITIFNNVGGYEGLFLGGPRP
TWVFVCRQRFRVHPQLCDGPIVAFTVLHNVNCCRGLIYVTSQGFLKICQL
PSAYNYDNYWPVQKVPLHGTPHQVTYYAEQSLYPLIVSVPQVRPLNQVLS
SMADQELGLHIENDVTIGDDLQKVYTVDEFEVRIMELGKPSGRWETRFTI
PMQSFENALTVRIVTLQNTSTKENETLMAIGTAYVLGEDVAARGRVLLFS
FSKSENSQNLVTEVYSKESKGAVSAVASLQGHLLIASGPKITLNKWTGSE
LTAVAFYDAPLHVVSLNIVKNFVLFGDIHKSIYFLSWKEQGSQLSLLAKD
FGSLDCFATEFLIDGSTLSLVVSDSDKNVQVICPIFCIINLKNLAFCLHL
LFTSLPISLSAMHWQLETSYLHLVHE*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0003676nucleic acid binding
Vocabulary: Cellular Component
TermDefinition
GO:0005634nucleus