Sh_014B07_contig-1_p000010

Overview
NameSh_014B07_contig-1_p000010
Unique NameSh_014B07_contig-1_p000010
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length1081
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_014B07_contig-1contigSh_014B07_contig-1:351..5470
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR023299
InterProIPR006068
InterProIPR023214
InterProIPR008250
InterProIPR018303
InterProIPR001757
InterProIPR023298
InterProIPR004014
InterProIPR006408
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_014B07_contig-1_t000010Sh_014B07_contig-1_t000010R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_014B07_contig-1_p000010 ID=Sh_014B07_contig-1_p000010|Name=Sh_014B07_contig-1_p000010|organism=R570 Sugarcane cultivar|type=polypeptide|length=1081bp
MNHPVLVPVSPPASFIPARGQKNSASIGEQEQERGANSKGRKGKTAIMHS
GVDARPGPLLPLPGTSPVPCSGRRVPWPRSGLGAALRLPNSPHGRLRFGP
IPAGDLCRRAHREKLPVAVLVSKSTLQSEHGVSLQSECVVPQGVKAAGFQ
ISADELASIVENRDTEKLTVLGQLDGIADKLATSFTDGITTDVSSLNQRQ
DMYGVNKFTESEVRSLWEFVWEALQDTTLVILIACALVSFVVGVATEGWP
SGAHDGIGIFTSILLVVSVTATSNYQQSLQFRDLDKEKRKISIQVTRDGF
RQRILIDDLLPGDVVHLAVGDQVPADGLFISGYSVLINESSLTGESEPVV
INEHNPFLLSGTKVLDGSCKILVTAVGMRTQWGKLMSAVTESGDDETPLQ
GKLNGVANTIGNIGLFFALLTFVILSQGLVAQKYSDGLLLSWSGEDVLEI
LEHFAIAVTIVVVAVPEGLPLAVTLSLAFAMKKMMNEKALVRQLAACETM
GSATVICSDKTGTLTTNRMSVMKACICGNTLEVTSPPVLSSFSSKLPEFA
LQILLESIFNNTAGEVVINQDGNCQILGTPTEAALLDFALSIGGDFKEKW
QEAKIVKVEPFNSTKKRMNIILELPSGGYRAHCKGASEVVLAACDKFIDA
RGTIVALDKAATKKLSDIIETFSKEALRTLCLAYREMDDSFSINEQIPLQ
GYTCIGIVGIKDPLRPGVRQSVATCRSAGIAVRMVTGDNINTAMAIAREC
GILTEDGIAIEGAEFREKNPKELLELIPKMQVLARSSPLDKHTLVKHLRT
TFNEVVAVTGDGTNDAPALREADIGLAMGIAGTEVAKESADVVILDDNFS
TIVTVAKWGRSVYVNIQKFVQFQLTVNVVALLVNFSSACFTGDAPLTAVQ
LLWVNMIMDTLGALALATEPPDDNLMKKSPVGRAGKFITKVMWRNIVGQS
IFQFVVIWYLQTQGKYLFGLEGSEADTVLNTIIFNTFVFCQVFNEISSRD
MEEINVIKGLPQNSIFMCILAGTITFQFILVQYLGDFANTTPLTQLQWLV
SILFGLLGMPIAAAIKLIPAEPHEDGGRIS*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0000166nucleotide binding
GO:0005388calcium-transporting ATPase activity
GO:0005524ATP binding
Vocabulary: Cellular Component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: Biological Process
TermDefinition
GO:0070588calcium ion transmembrane transport