Sh_014B07_contig-1_p000020

Overview
NameSh_014B07_contig-1_p000020
Unique NameSh_014B07_contig-1_p000020
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length669
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_014B07_contig-1contigSh_014B07_contig-1:6072..11896
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
EC2.7.7.7
InterProIPR001126
InterProIPR022880
InterProIPR017061
InterProIPR017961
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_014B07_contig-1_t000020Sh_014B07_contig-1_t000020R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_014B07_contig-1_p000020 ID=Sh_014B07_contig-1_p000020|Name=Sh_014B07_contig-1_p000020|organism=R570 Sugarcane cultivar|type=polypeptide|length=669bp
MSAAAGTPPEGGGDRPWQSYHTAYTNAKAGMEGVDKEKVQKVIYEMSKGS
KYFENEQRKEAVTKLKIEHLRAQCAALTDNDISHFQKVAEKKMLELEASR
DLSKIWLHTDMDAFYAAVETLENPSLKGKPLAVGSMSMIATASYEARKFG
VRAAMPGFIGCKLCPGLVFVPPNFERYAHYSGLTRKVFQRYDPNFIATSL
DEAYLNITNVCIERGITGEEVATELRSAIHQETGLTCSAGVAPNRMIAKV
CSDVNKPNGQFILPNNREAVLTFVSTLPIRKIGGIGKVTEQMLRQVLGIS
TCQEMLQKAAFLCALFSEGSADFFLSVGLGLGGTETPEQRQRKSISCERT
FSATNDSSLLFEKLDNLAENLTDDLRKEGLKGKTLTLKLKTADFEVRTRA
VTTRNYINSKEDILVYATKLLKAEMPLSLRLMGLRMSQLHDEKDDPSTST
QKTLDIFFRSSNSNSNVNGINVQRITNASGQDNDSISLTTKEEYLVPDAG
TGVSTDQQDFFLHDESCFIPEQRSLGNYSNEAVLSNPLGGINLDDVSSSA
KKVTPTKKLNGPDPLISPKAVASSSKPDQQSWIDGYICSICGFELPPGFE
EERLEHSDFHLAETLQQEEAVDGTRHIPNERLAERPCSTTPTPKKKLKSS
KEGRHIPIDAFFTKGNKN*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0006281DNA repair
Vocabulary: Molecular Function
TermDefinition
GO:0003887DNA-directed DNA polymerase activity
GO:0003684damaged DNA binding