Sh_014C04_p000010

Overview
NameSh_014C04_p000010
Unique NameSh_014C04_p000010
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length454
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_014C04contigSh_014C04:1..1479
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_014C04_t000010Sh_014C04_t000010R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_014C04_p000010 ID=Sh_014C04_p000010|Name=Sh_014C04_p000010|organism=R570 Sugarcane cultivar|type=polypeptide|length=454bp
MHRGFEEISDEEWSNHTFKPSRVLKRPNQRPSRPPPPIDSFAYNPKACSA
AGTSTATVVLSDDDSDFDLGADGGSRRAAKSQRVLKRPHNGPPSRPSPPV
KSFRRNPQPSNAAAAFGVSDSEDDDFVLTDDDFDRPTSSLRTSSLRRKGK
SQRPLKGPQLKPHLRAPPPVNSFSHNAKRSKFAADVGLSNSEDDEFDLTE
SSSLHRSAKRQPVQKRPQHKPRLQDPQSYGSPCHNPKPSKAAATTGLSDS
DDDDFNITDTDVDLPASLSRTSRPRRTTSRRLTSFAIDISEEDEEDLADD
DFDYQDPRPPQQRPSGRRFVIGDDDDSDVPVAVDDDDDGVNWSELEKEDE
DEGYNGERSVNVEEPEEDVVGMALRKCSRISSDLRKELFGSSARDCESYA
EIDASTCRIVTQEDVNAACTSEKSGFEPVLKPYQLVGVNFLLLLHRKSIG
GGEA
back to top