Sh_014C04_t000110

Overview
NameSh_014C04_t000110
Unique NameSh_014C04_t000110
TypemRNA
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length1074
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_014C04contigSh_014C04:74183..76298
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Properties
Property NameValue
NoteTranscription factor bHLH111
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
Sh_014C04_g000110Sh_014C04_g000110R570 Sugarcane cultivargene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Sh_014C04_p000110Sh_014C04_p000110R570 Sugarcane cultivarpolypeptide


Sequences
The following sequences are available for this feature:

mRNA sequence

>Sh_014C04_t000110 ID=Sh_014C04_t000110|Name=Sh_014C04_t000110|organism=R570 Sugarcane cultivar|type=mRNA|length=1074bp
ATGGTCAAGCTGACGTTCTGCATGATTTTCAGAAGCGTGGTAGCGCACGG
GGGCAGCGGCTACAGAGGGAACTTCCTGTCTCTGCTCGAAGCGAAGAACG
TGATGCCGGAGATGTTCGAGGATGTTCCTGCGTCGGCATGCGACTACCTC
GGAGTCGGAAGGGTGGGCGCCGCCGCCAGTAACATGGCCGGCCCAGCCGC
CGCCGCCTTTGGCATCGGCAGCGTCGACCCGTACTCTACTGTTGCCAGCA
GTGCTCCTCCAGTCAAGCATGAGACCGCAAGCTTGCCATCGCCACTCGTG
TACTCGGGGGACAGTGTGGTGCACGGGAGCAGCATGGGCTGCAAGCCGTG
CTACGACCACGAGGAGAAACCAGCTGATGACAGCCAGCGGCAGGGTTTTG
GAGCTCCCATGGCCGCTTTTCTGCAGCAAACGGTCCCAAGCCGAGTGGAG
CTTCAGAGTGTTCTGGGTTATTCAAGCATGGTGTCTGAAAGACTGGAGTC
TTCCTTCGGCGTGGGGAGCTTGCCGGATGCCGGTTCTTTCAGTGACTACA
ACAGCAACAGGTCAAGCGCAGACTTCATGTCCAGCAACAGCAACAGGCAG
GAGCAAATTATCAGGCCGGGGATGGGCATGGGCGGTAGCAGCAGTGGAAG
TGGAGCTGCGACAAGTGTAACCTCGAGGAGGAAATCAGAGGAAAGGGTTG
GAGGAAACACGAAGAAATCTAAGCAGGAGGCTTCCCACAAGGCGTCGCCT
CCCAGGCCTCAAGCGCCCAAAGTGAAGCTGGGAGAGAAGATCACAGCGCT
GCAGCAAATCGTGTCACCTTTTGGGAAGACTGATACATCATCGGTGCTGT
TTGAAACGATCGAGTACATCAAATTTCTTCATGAGCAGATACAGCTGTTT
AGTGAACCGTACATGACGAAGAGCACGTACAAGGGTCACATTCGACGCAG
AGGCGAAGAGAAGAAAGAGGAGGAAAGCGGGACGGGGCATGACTTGAGGG
GCAGAGGGCTCTGCCTGGTCCCTGTTTCGCTGACCTCGCAGGCATACCAC
GATGACACCCTGCCGGACTGCTGA
back to top

protein sequence of Sh_014C04_p000110

>Sh_014C04_p000110 ID=Sh_014C04_p000110|Name=Sh_014C04_p000110|organism=R570 Sugarcane cultivar|type=polypeptide|length=358bp
MVKLTFCMIFRSVVAHGGSGYRGNFLSLLEAKNVMPEMFEDVPASACDYL
GVGRVGAAASNMAGPAAAAFGIGSVDPYSTVASSAPPVKHETASLPSPLV
YSGDSVVHGSSMGCKPCYDHEEKPADDSQRQGFGAPMAAFLQQTVPSRVE
LQSVLGYSSMVSERLESSFGVGSLPDAGSFSDYNSNRSSADFMSSNSNRQ
EQIIRPGMGMGGSSSGSGAATSVTSRRKSEERVGGNTKKSKQEASHKASP
PRPQAPKVKLGEKITALQQIVSPFGKTDTSSVLFETIEYIKFLHEQIQLF
SEPYMTKSTYKGHIRRRGEEKKEEESGTGHDLRGRGLCLVPVSLTSQAYH
DDTLPDC*
back to top

mRNA from alignment at Sh_014C04:74183..76298+

Legend: polypeptideCDSexon
Hold the cursor over a type above to highlight its positions in the sequence below.
>Sh_014C04_t000110 ID=Sh_014C04_t000110|Name=Sh_014C04_t000110|organism=R570 Sugarcane cultivar|type=mRNA|length=2116bp|location=Sequence derived from alignment at Sh_014C04:74183..76298+ (R570 Sugarcane cultivar)
ATGGTCAAGCTGACGTTCTGCATGATTTTCAGAAGCGTGGTAGCGCACGG GGGCAGCGGCTACAGAGGGAACTTCCTGTCTCTGCTCGAAGCGAAGAACG TGATGCCGGAGATGTTCGAGGATGTTCCTGCGTCGGCATGCGACTACCTC GGAGTCGGAAGGGTGGGCGCCGCCGCCAGTAACATGGCCGGCCCAGCCGC CGCCGCCTTTGGCATCGGCAGCGTCGACCCGTACTCTACTGTTGCCAGCA GTGCTCCTCCAGTCAAGCATGAGACCGCAAGCTTGCCATCGCCACTCGTG TACTCGGGGGACAGTGTGGTGCACGGGAGCAGCATGGGCTGCAAGCCGTG CTACGACCACGAGGAGAAACCAGCTGATGACAGCCAGCGGCAGGGTTTTG GAGCTCCCATGGCCGCTTTTCTGCAGCAAACGGTCCCAAGCCGAGTGGAG CTTCAGAGTGTTCTGGGTTATTCAAGCATGGTGTCTGAAAGACTGGAGTC TTCCTTCGGCGTGGGGAGCTTGCCGGATGCCGGTTCTTTCAGTGACTACA ACAGCAACAGGTCAAGCGCAGACTTCATGTCCAGCAACAGCAACAGGCAG GAGCAAATTATCAGGCCGGTAAGCTTTGACTTTCTTACATAAATCAAAGT AGCTTCTCGGTCGTCTACGATGCGTACAACCGTATACCAATACAGAAAAA GTGAAACCTGTTGAATTCCGCGCTTGATTCTTGCAGGGGATGGGCATGGG CGGTAGCAGCAGTGGAAGTGGAGCTGCGACAAGTGTAACCTCGAGGAGGA AATCAGAGGAAAGGGTTGGAGGAAACACGAAGAAATCTAAGCAGGAGGCT TCCCACAAGGCGTCGCCTCCCAGGGTACGTAATGATGAGAAAATTAGGGC GAAGGTGTTAAGCCCGGAACTTTTGAGCAAGCATTCTCACGATTTTGTTT CAAACTTACTTAGCCTCAAGCGCCCAAAGTGAAGCTGGGAGAGAAGATCA CAGCGCTGCAGCAAATCGTGTCACCTTTTGGGAAGGTACGGGATTCTTGC CGTGCGCAACTTTTGCTTCACATTGCTGAAATCCAGTTTATTTCTGTTCC TTCTCTTTTGGTTGATGATATATGACTCGCATAGAACACTTCATTTTGCC AGACTGATACATCATCGGTGCTGTTTGAAACGATCGAGTACATCAAATTT CTTCATGAGCAGATACAGGTAATAGCTCCATGTACACAATATGCCATATC TAATATGTTTGTGTTACATAACTTTCTACTAGTTGAAGAACACACTAAGA TCCTTAATCACCGATTAAGGTCTTGGTTGGATGCAGTCGGATTCGCATCA ATCCACATATGTTGGAGTGGATTGGATTGGAACTACTCATCAATCCACCC CAACACATGTGGATTGAGATGAATCCAATAACATCCCAACAAGGCCTAAC TATATATAAATTGCAGCTGAGAAATGAGAATATATAGGCCATGTAATTAT GTAATATATCATCCAAGATAATATATAGACTGAGAAGCAGCCATTTGCCC TGGTTTCGTCAGTGAGCATACCAGATTGACCTTTTTATCAGTGGACTTCC AAGTCATGCCCAAGTCCTGTCTTGTGTAACAATCATGCTGTCTTTTTCCA GAGTCCGGACACCGATAGACTTGAGGGAAAGGGGTCAATTACACTGTCAC AACCATTAGTCCACCTTTTTTCTGAAGTCTAGTAATGCTGACAAGTACTC TAGATTGCTGTTTTTTTAAAAGCTAACTACCATGCTGATCCACTCTTCCA CTCTGCAGCTGTTTAGTGAACCGTACATGACGAAGAGCACGTACAAGGTA CCACCACTAAAGCAACAAATATAATATTTTTCAATAAATCAATTGACAAG AATGCGTGCGTGGCCACGACTCGTTGCCGGTATTTTATTTCAGGGTCACA TTCGACGCAGAGGCGAAGAGAAGAAAGAGGAGGAAAGCGGGACGGGGCAT GACTTGAGGGGCAGAGGGCTCTGCCTGGTCCCTGTTTCGCTGACCTCGCA GGCATACCACGATGACACCCTGCCGGACTGCTGAGCGCCCGCCTACAGGA GCTACCTGTACCCATG
back to top

Coding sequence (CDS) from alignment at Sh_014C04:74183..76298+

>Sh_014C04_t000110 ID=Sh_014C04_t000110|Name=Sh_014C04_t000110|organism=R570 Sugarcane cultivar|type=CDS|length=1074bp|location=Sequence derived from alignment at Sh_014C04:74183..76298+ (R570 Sugarcane cultivar)
ATGGTCAAGCTGACGTTCTGCATGATTTTCAGAAGCGTGGTAGCGCACGG
GGGCAGCGGCTACAGAGGGAACTTCCTGTCTCTGCTCGAAGCGAAGAACG
TGATGCCGGAGATGTTCGAGGATGTTCCTGCGTCGGCATGCGACTACCTC
GGAGTCGGAAGGGTGGGCGCCGCCGCCAGTAACATGGCCGGCCCAGCCGC
CGCCGCCTTTGGCATCGGCAGCGTCGACCCGTACTCTACTGTTGCCAGCA
GTGCTCCTCCAGTCAAGCATGAGACCGCAAGCTTGCCATCGCCACTCGTG
TACTCGGGGGACAGTGTGGTGCACGGGAGCAGCATGGGCTGCAAGCCGTG
CTACGACCACGAGGAGAAACCAGCTGATGACAGCCAGCGGCAGGGTTTTG
GAGCTCCCATGGCCGCTTTTCTGCAGCAAACGGTCCCAAGCCGAGTGGAG
CTTCAGAGTGTTCTGGGTTATTCAAGCATGGTGTCTGAAAGACTGGAGTC
TTCCTTCGGCGTGGGGAGCTTGCCGGATGCCGGTTCTTTCAGTGACTACA
ACAGCAACAGGTCAAGCGCAGACTTCATGTCCAGCAACAGCAACAGGCAG
GAGCAAATTATCAGGCCGGGGATGGGCATGGGCGGTAGCAGCAGTGGAAG
TGGAGCTGCGACAAGTGTAACCTCGAGGAGGAAATCAGAGGAAAGGGTTG
GAGGAAACACGAAGAAATCTAAGCAGGAGGCTTCCCACAAGGCGTCGCCT
CCCAGGCCTCAAGCGCCCAAAGTGAAGCTGGGAGAGAAGATCACAGCGCT
GCAGCAAATCGTGTCACCTTTTGGGAAGACTGATACATCATCGGTGCTGT
TTGAAACGATCGAGTACATCAAATTTCTTCATGAGCAGATACAGCTGTTT
AGTGAACCGTACATGACGAAGAGCACGTACAAGGGTCACATTCGACGCAG
AGGCGAAGAGAAGAAAGAGGAGGAAAGCGGGACGGGGCATGACTTGAGGG
GCAGAGGGCTCTGCCTGGTCCCTGTTTCGCTGACCTCGCAGGCATACCAC
GATGACACCCTGCCGGACTGCTGA
back to top