Sh_014D12_p000050

Overview
NameSh_014D12_p000050
Unique NameSh_014D12_p000050
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length539
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_014D12contigSh_014D12:74781..76479
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
EC2.7.1.73
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_014D12_t000050Sh_014D12_t000050R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_014D12_p000050 ID=Sh_014D12_p000050|Name=Sh_014D12_p000050|organism=R570 Sugarcane cultivar|type=polypeptide|length=539bp
MPLEPPPSGGRSGCRGSLESFRRAAKRPSALRHPRRPGSSAQIRSPEAKR
KYSIACFEALINCYWGAKRARSALGAGRSTSNKRCVLEVYSRRQPYMGGP
KRARSAFGGSGGETGLSWQSLPPLPLDNRCLRLIHSHRLASWGAKRSRSA
LGGDRKSSLSVRSLPRPNNSGSSSTCTRDWANLGDGPVGLIAELALASDV
ADYVRFRAVCKPWRQCSPDPRAGGLDARFLPRRWIMLDKALAGSCHHRFL
NVSTGECIRMGLPELLEGEHRFLKVTPEGLLLLFHKSTMIARLLNPLTRQ
LIDLPPLTALMQGGDSDEPEEQGPFVQTVGLTEDSTVAVSCCYPMRLAFA
KPGDDNWTVVNDGYINSALPFAGRFYCATYRGVMVLNNTKDQQQPPRLTM
VADLEESFIYFSQMMHSLHLVDNGGELMLVHRTIGQDKFRKYDVYRLDLE
AGILIPVKCLNGRAVFMGTQCTISVSVEAFPYVTADTIYLGYECDSKTEE
YNIADGSRYSRSRIYDGSVSPDTIVESLICYCIQDQDI*
back to top