Sh_014F11_p000060

Overview
NameSh_014F11_p000060
Unique NameSh_014F11_p000060
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length88
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_014F11contigSh_014F11:95542..98739
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR009846
InterProIPR017089
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_014F11_t000060Sh_014F11_t000060R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_014F11_p000060 ID=Sh_014F11_p000060|Name=Sh_014F11_p000060|organism=R570 Sugarcane cultivar|type=polypeptide|length=88bp
MQASDRFNINSQLEHLQAKYVGTGHADLSRFEWAVNIQRDSYASYIGHYP
MLAYFAIAENESIGRERYNFMQKMLLPCGLPPERDED*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0000398mRNA splicing, via spliceosome