Sh_014G09_p000010

Overview
NameSh_014G09_p000010
Unique NameSh_014G09_p000010
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length209
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_014G09contigSh_014G09:9336..10325
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR010979
InterProIPR015886
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_014G09_t000010Sh_014G09_t000010R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_014G09_p000010 ID=Sh_014G09_p000010|Name=Sh_014G09_p000010|organism=R570 Sugarcane cultivar|type=polypeptide|length=209bp
MFSFQSRIHPLQIASNLPRESCEALHRSIQEVVKYAVEVDADMVRFPKEW
LFHHRWGKKLGKVNGKKIEFITAGGRTTAYVPQLQKLIGTQSSKMIAANL
ERLAENGDTKDSGTEGEDADILIPKKRAATSRAARRQQNKDTVGASSRKA
RGNGGGNKKPDADVEPAEPETVVTESNGEQVLDQPNSNASNKSDQVTRRS
SRKVKPRK*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0003676nucleic acid binding
GO:0003684damaged DNA binding
GO:0003906DNA-(apurinic or apyrimidinic site) lyase activity
GO:0008270zinc ion binding
GO:0016799hydrolase activity, hydrolyzing N-glycosyl compounds
Vocabulary: Biological Process
TermDefinition
GO:0006289nucleotide-excision repair