Sh_014G09_p000040

Overview
NameSh_014G09_p000040
Unique NameSh_014G09_p000040
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length86
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_014G09contigSh_014G09:16858..17115
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_014G09_t000040Sh_014G09_t000040R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_014G09_p000040 ID=Sh_014G09_p000040|Name=Sh_014G09_p000040|organism=R570 Sugarcane cultivar|type=polypeptide|length=86bp
MVAYLISRRKTPYETIYHHGYCLEVRWCENVAYPSIQCNLCDLGGYAMLP
SCHVSTRLSYEAMFPRGFHTNLPVSLDTFNADYYY*
back to top