Sh_014G09_p000090

Overview
NameSh_014G09_p000090
Unique NameSh_014G09_p000090
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length772
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_014G09contigSh_014G09:60134..64953
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR004131
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_014G09_t000090Sh_014G09_t000090R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_014G09_p000090 ID=Sh_014G09_p000090|Name=Sh_014G09_p000090|organism=R570 Sugarcane cultivar|type=polypeptide|length=772bp
MAASSAFLPELGTQVVVPVAAVVGIAFAVLQWVLVSKVKLTPEPRRADGS
AGKSGGAGASEYLIEEEEGLNEHNVVVKCAEIQNAISEGATSFLFTEYKY
VGLFMGIFAVLIFLFLGSVESFSTKSQPCHYSKGKMCKPALANAIFSTIA
FVLGAITSLVSGFLGMKIATYANARTTLEARKGVGKAFITAFRSGAVMGF
LLAASGLFVLYIAINLFGIYYGDDWEGLYEAITGYGLGGSSMALFGRVGG
GIYTKAADVGADLVGKVERNIPEDDPRNPAVIADNVGDNVGDIAGMGSDL
FGSYAESSCAALVVASISSFGINHEFTPMLYPLLISSVGIIACLITTLFA
TDFFEIKAVDEIEPALKKQLIISTAVMTVGIALVSWLGLPYTFTIYNFGV
QKTVYNWQLFLCVAVGLWAGLVIGFVTEYYTSNAYSPVQDVADSCRTGAA
TNVIFGLALGYKSVIIPIFAIAFSIFLSFSLAAMYGVAVAALGMLSTIAT
GLAIDAYGPISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAI
GSAALVSLALFGAFVSRAAISTVDVLSPKVFIGLIVGAMLPYWFSAMTMK
SVGSAALKMVEEVRRQFNTIPGLMEGTTKPDYATCVKISTDASIKEMIPP
GALVMLTPLIVGILFGVETLSGVLAGALVSGVQIAISASNTGGAWDNAKK
YIEAGASEHARTLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMA
VESLVFAPFFATHGGILFKWL*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0004427inorganic diphosphatase activity
GO:0009678hydrogen-translocating pyrophosphatase activity
Vocabulary: Biological Process
TermDefinition
GO:0015992proton transport
Vocabulary: Cellular Component
TermDefinition
GO:0016020membrane