Sh_014G09_p000100

Overview
NameSh_014G09_p000100
Unique NameSh_014G09_p000100
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length501
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_014G09contigSh_014G09:83599..85471
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR027417
InterProIPR011991
InterProIPR002182
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_014G09_t000100Sh_014G09_t000100R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_014G09_p000100 ID=Sh_014G09_p000100|Name=Sh_014G09_p000100|organism=R570 Sugarcane cultivar|type=polypeptide|length=501bp
MVGVGELLASAALKQVAGMLGTAIWDAIASQLKLSDELKYLRDTLATIVN
VKSDKRLMKDGDARIWMRELKAAAYDMEDMVMEFEGDILRNRDGSLSNNS
TMEISIPVKLRLTMPSKLKKMKETLEKILNLRRLDSMADTSSDDRDVIQM
RATGPCLEQGIVGRDKDKAELMKLLQEDCKHTIIPIYGFGGLGKTTLAQM
VFDDSTTKRDFDIRAWVYVSTKFSNENIGRSIISQVDGKSKQYDLPSVQM
RVGTILSGKKFLIVLDDLWEENTSNLNQLQAMLKGGAPGCKIVVTTRSEQ
VAKRMNRELPFKLGALPYDDCLKLFKDKAFPNGSEESDEFIKVGEKIVKK
CGGVPLAVKSLADRLLDMPLRKWEETLKSELWEGERDPTTAIASTAVLPS
LKISYYYMPYYLRPCFVYFAAFPKGFVIEKRDLIHRWIALGFVSTTDAEV
YLQELRQMSFVEATSISTSVSYIIYIHTSLLYCCTPFVVSYCCYLSYMVH
*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0043531ADP binding