Sh_014H10_p000020

Overview
NameSh_014H10_p000020
Unique NameSh_014H10_p000020
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length327
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_014H10contigSh_014H10:3131..4111
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR029058
InterProIPR013094
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_014H10_t000020Sh_014H10_t000020R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_014H10_p000020 ID=Sh_014H10_p000020|Name=Sh_014H10_p000020|organism=R570 Sugarcane cultivar|type=polypeptide|length=327bp
MAGSGASDDEVIFEMAQFIRVYKSGRVERFFGSDPVPTSTDAATGVASKD
HAVSPDVAVRLYLPPPAKETEDNGGSRKKLPILVYFHGGGFCLHTAFNFV
FHAYLTSLAARARAIIVSVEYRLAPEHPLPAAYDDSWRALVWVASHATGS
GEEPWLTDHGDFSRLCVGGDSAGANIAHHMAMRAGADPLPHGARISGVAL
VHPYFLGADRVASEETDPALVENVVTMWRVVCPGTSGMDDPWINPLAVGA
PGLEGLACARVLVCLAEKDVCRDRGRAYAEELRASGWAGEVEVLEVNGQG
HCFHLVDFVCADAVAQDDVISRFVNL*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0016787hydrolase activity
Vocabulary: Biological Process
TermDefinition
GO:0008152metabolic process