Sh_014H10_p000080

Overview
NameSh_014H10_p000080
Unique NameSh_014H10_p000080
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length373
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_014H10contigSh_014H10:42239..49406
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
EC3.1.1.79
EC4.1.1.5
InterProIPR029058
InterProIPR013094
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_014H10_t000080Sh_014H10_t000080R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_014H10_p000080 ID=Sh_014H10_p000080|Name=Sh_014H10_p000080|organism=R570 Sugarcane cultivar|type=polypeptide|length=373bp
MNFHTASFYASAAISTAPKIPAGLDSGRFACPNQRSLGTRTFRSPASLVA
TTPTRCTLANALDPSSDIVLDTPFFRIYSDRRIDRLDGTDTVPASFDPST
GVTSKDIVIDSDTGLYVRLYLPSTATGSDDSKKLPVIVYFHGGGFVSHSA
ASPPYQPFLNTLAAKAGLLIVSVNYRLAPEHPLPAGYEDSFRALKWAASG
SGDPWLSRHGDLGRIFLAGDSAGGNFVHNVAMMAATSEVRIEGAVLLQPG
FAGKERIDGEKPESVALTEKLWGIVCPEATDGVDDPRMNPLAAAAPSLRS
LPCERVLVCAGELDFLRARNRAYYEALAASGWGGTVEWFESKGKGHQFFL
QNPGCGEAVELIDRLGAFFAGK*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0016787hydrolase activity
Vocabulary: Biological Process
TermDefinition
GO:0008152metabolic process