Sh_014H10_t000100

Overview
NameSh_014H10_t000100
Unique NameSh_014H10_t000100
TypemRNA
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length942
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_014H10contigSh_014H10:84606..85550
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Properties
Property NameValue
NoteTuliposide A-converting enzyme b2, amyloplastic
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
Sh_014H10_g000100Sh_014H10_g000100R570 Sugarcane cultivargene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Sh_014H10_p000100Sh_014H10_p000100R570 Sugarcane cultivarpolypeptide


Sequences
The following sequences are available for this feature:

mRNA sequence

>Sh_014H10_t000100 ID=Sh_014H10_t000100|Name=Sh_014H10_t000100|organism=R570 Sugarcane cultivar|type=mRNA|length=942bp
ATGGATCCGAGCTCCGATATCATACTCGACACTCCGTACTTCCGCATCTA
CAGCGACCGGCGCATCGACCGCTTGGTCGGCACCGATACCGTGCCGGCCG
GCTTTGATCCCACCACCGGCGTCACCTCCAAAGATGTCGTCATAGACAGC
AACACCGGCCTCTACGTTCGCCTGTACCTCCCGGACACGGCCACCACCGG
GTCTGACGACGCCAAGAAGCTCCCGGTGCTAGTCTACTTCCACGGCGGCG
GCTTTGTCGTCAACTCGGCAGCGTCTCCGCACTATCAGCCCTTCCTCAAC
ACCCTGGCCGCGAAGGCCGGCCTGCTCATCGTCTCCGTGAACTACCGCCT
CGCGCCAGAGCACCCGCTGCCGGCAGGCTACGAGGACACCTTCCGCGCGC
TCAAGTGGGTGGCCTCTGGTAGCGGGGACCCCTGGCTGTCACATCACGGC
GACCTGGGCCGCGTCTTCCTCGCCGGCGACAGCGCCGGCGGGAACTTTGT
GCACAACGTCGCTATGATGGCCGGCGCCGCGTCGGAGGTACGAATCGAGG
GTGCGCTCCTCCTGCACCCCGGGTTCGGCGGCAGGGAGCGCATCGACGGA
GAGAAGCCGGAGTCTGTGGCGCTCACGGAGAAGCTGTGGGGGATCGTGTG
CCTCGAGGCGACGGACGGCGCGGACGACCCGCGGGTGAATCCCTTGGCCG
CCGCGGCGCCGAGCCTGCGGAACCTGCCGTGCGAGAGGGTGCTCGTCTGC
GCGGCAGAGCTGGACTTCCTGCGGCCGAGGAACAGGGCGTACTACGAGGC
CCTCGCGGCAAGCGGGCGGGGCGGCACGGTGGATTGGTTCGAGTCCAAGG
GCAAGGAGCACGTCTTCTTCCTCCACAACCCCGGCTGCGGCGAGGCCGTG
GAGCTCATGGATCGACTGGTGGCGTTCTTTGCTGGGAACTGA
back to top

protein sequence of Sh_014H10_p000100

>Sh_014H10_p000100 ID=Sh_014H10_p000100|Name=Sh_014H10_p000100|organism=R570 Sugarcane cultivar|type=polypeptide|length=314bp
MDPSSDIILDTPYFRIYSDRRIDRLVGTDTVPAGFDPTTGVTSKDVVIDS
NTGLYVRLYLPDTATTGSDDAKKLPVLVYFHGGGFVVNSAASPHYQPFLN
TLAAKAGLLIVSVNYRLAPEHPLPAGYEDTFRALKWVASGSGDPWLSHHG
DLGRVFLAGDSAGGNFVHNVAMMAGAASEVRIEGALLLHPGFGGRERIDG
EKPESVALTEKLWGIVCLEATDGADDPRVNPLAAAAPSLRNLPCERVLVC
AAELDFLRPRNRAYYEALAASGRGGTVDWFESKGKEHVFFLHNPGCGEAV
ELMDRLVAFFAGN*
back to top

mRNA from alignment at Sh_014H10:84606..85550-

Legend: exonpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>Sh_014H10_t000100 ID=Sh_014H10_t000100|Name=Sh_014H10_t000100|organism=R570 Sugarcane cultivar|type=mRNA|length=945bp|location=Sequence derived from alignment at Sh_014H10:84606..85550- (R570 Sugarcane cultivar)
GCCATGGATCCGAGCTCCGATATCATACTCGACACTCCGTACTTCCGCAT CTACAGCGACCGGCGCATCGACCGCTTGGTCGGCACCGATACCGTGCCGG CCGGCTTTGATCCCACCACCGGCGTCACCTCCAAAGATGTCGTCATAGAC AGCAACACCGGCCTCTACGTTCGCCTGTACCTCCCGGACACGGCCACCAC CGGGTCTGACGACGCCAAGAAGCTCCCGGTGCTAGTCTACTTCCACGGCG GCGGCTTTGTCGTCAACTCGGCAGCGTCTCCGCACTATCAGCCCTTCCTC AACACCCTGGCCGCGAAGGCCGGCCTGCTCATCGTCTCCGTGAACTACCG CCTCGCGCCAGAGCACCCGCTGCCGGCAGGCTACGAGGACACCTTCCGCG CGCTCAAGTGGGTGGCCTCTGGTAGCGGGGACCCCTGGCTGTCACATCAC GGCGACCTGGGCCGCGTCTTCCTCGCCGGCGACAGCGCCGGCGGGAACTT TGTGCACAACGTCGCTATGATGGCCGGCGCCGCGTCGGAGGTACGAATCG AGGGTGCGCTCCTCCTGCACCCCGGGTTCGGCGGCAGGGAGCGCATCGAC GGAGAGAAGCCGGAGTCTGTGGCGCTCACGGAGAAGCTGTGGGGGATCGT GTGCCTCGAGGCGACGGACGGCGCGGACGACCCGCGGGTGAATCCCTTGG CCGCCGCGGCGCCGAGCCTGCGGAACCTGCCGTGCGAGAGGGTGCTCGTC TGCGCGGCAGAGCTGGACTTCCTGCGGCCGAGGAACAGGGCGTACTACGA GGCCCTCGCGGCAAGCGGGCGGGGCGGCACGGTGGATTGGTTCGAGTCCA AGGGCAAGGAGCACGTCTTCTTCCTCCACAACCCCGGCTGCGGCGAGGCC GTGGAGCTCATGGATCGACTGGTGGCGTTCTTTGCTGGGAACTGA
back to top

Coding sequence (CDS) from alignment at Sh_014H10:84606..85550-

>Sh_014H10_t000100 ID=Sh_014H10_t000100|Name=Sh_014H10_t000100|organism=R570 Sugarcane cultivar|type=CDS|length=942bp|location=Sequence derived from alignment at Sh_014H10:84606..85550- (R570 Sugarcane cultivar)
ATGGATCCGAGCTCCGATATCATACTCGACACTCCGTACTTCCGCATCTA
CAGCGACCGGCGCATCGACCGCTTGGTCGGCACCGATACCGTGCCGGCCG
GCTTTGATCCCACCACCGGCGTCACCTCCAAAGATGTCGTCATAGACAGC
AACACCGGCCTCTACGTTCGCCTGTACCTCCCGGACACGGCCACCACCGG
GTCTGACGACGCCAAGAAGCTCCCGGTGCTAGTCTACTTCCACGGCGGCG
GCTTTGTCGTCAACTCGGCAGCGTCTCCGCACTATCAGCCCTTCCTCAAC
ACCCTGGCCGCGAAGGCCGGCCTGCTCATCGTCTCCGTGAACTACCGCCT
CGCGCCAGAGCACCCGCTGCCGGCAGGCTACGAGGACACCTTCCGCGCGC
TCAAGTGGGTGGCCTCTGGTAGCGGGGACCCCTGGCTGTCACATCACGGC
GACCTGGGCCGCGTCTTCCTCGCCGGCGACAGCGCCGGCGGGAACTTTGT
GCACAACGTCGCTATGATGGCCGGCGCCGCGTCGGAGGTACGAATCGAGG
GTGCGCTCCTCCTGCACCCCGGGTTCGGCGGCAGGGAGCGCATCGACGGA
GAGAAGCCGGAGTCTGTGGCGCTCACGGAGAAGCTGTGGGGGATCGTGTG
CCTCGAGGCGACGGACGGCGCGGACGACCCGCGGGTGAATCCCTTGGCCG
CCGCGGCGCCGAGCCTGCGGAACCTGCCGTGCGAGAGGGTGCTCGTCTGC
GCGGCAGAGCTGGACTTCCTGCGGCCGAGGAACAGGGCGTACTACGAGGC
CCTCGCGGCAAGCGGGCGGGGCGGCACGGTGGATTGGTTCGAGTCCAAGG
GCAAGGAGCACGTCTTCTTCCTCCACAACCCCGGCTGCGGCGAGGCCGTG
GAGCTCATGGATCGACTGGTGGCGTTCTTTGCTGGGAACTGA
back to top