Sh_014J13_p000010

Overview
NameSh_014J13_p000010
Unique NameSh_014J13_p000010
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length189
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_014J13contigSh_014J13:305..5321
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR000979
InterProIPR029052
InterProIPR028661
InterProIPR024654
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_014J13_t000010Sh_014J13_t000010R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_014J13_p000010 ID=Sh_014J13_p000010|Name=Sh_014J13_p000010|organism=R570 Sugarcane cultivar|type=polypeptide|length=189bp
MVLVLALGDLHIPHRAPDLPAKFKSMLVPGKIQHIICTGNLCIKEVHDYL
KSLCPDLHITRGEYDEDARYPETKTLTIGQFKLGLCHGHQVVPWGDLDSL
AMLQRQLDVDILVTGHTHQFKAYKHEGGVVINPGSATGAYSSITYDVNPS
FVLMDIDGLRVVVYVYELIDGEVKVDKIDFKKTATMHA*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0042147retrograde transport, endosome to Golgi
Vocabulary: Cellular Component
TermDefinition
GO:0030904retromer complex