Sh_014J23_p000010

Overview
NameSh_014J23_p000010
Unique NameSh_014J23_p000010
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length318
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_014J23contigSh_014J23:1..954
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR001611
InterProIPR032675
InterProIPR003591
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_014J23_t000010Sh_014J23_t000010R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_014J23_p000010 ID=Sh_014J23_p000010|Name=Sh_014J23_p000010|organism=R570 Sugarcane cultivar|type=polypeptide|length=318bp
KLDGNSLTGTVPAWLGSLRPLGELDLSWNALTGGIPPELGNCSGLLKLSL
SNNHLTGSIPPEIGRLTSLNVLNLNKNSLTGAIPPSLQQCNKLYELRLSE
NSLEGPIPPELGQLTELQVILDLSRNRLSGEIPASLGSLVKLERLNLSSN
RLDGQIPSSLVQLTSLHRLNLSDNLLSGAVPAGLSSFPAASFVGNELCGA
PLTPCGPPSPARRLSGTEVVVIVAGIALVSAVVCVALLYTMLRVWSNWRA
VSISNSDGEESAHGGGHGSGGGKWGDGKYWKVGSPVSWSAEQRHSSVSET
ASVLHDKSTEAAGAGKS*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding