Sh_014J23_p000020

Overview
NameSh_014J23_p000020
Unique NameSh_014J23_p000020
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length94
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_014J23contigSh_014J23:64184..67556
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR016464
InterProIPR007741
InterProIPR012336
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_014J23_t000020Sh_014J23_t000020R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_014J23_p000020 ID=Sh_014J23_p000020|Name=Sh_014J23_p000020|organism=R570 Sugarcane cultivar|type=polypeptide|length=94bp
MAWRASLSRSVKEIRVLFCQSSPASAAAREFVKKNYGDIKARNPSLPFLV
RECSGVQPQLWARYDMGVERCVNLDGLTEAQIDKKLEELAKAG*
back to top