Sh_014K10_contig-1_p000010

Overview
NameSh_014K10_contig-1_p000010
Unique NameSh_014K10_contig-1_p000010
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length67
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_014K10_contig-1contigSh_014K10_contig-1:11095..11295
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_014K10_contig-1_t000010Sh_014K10_contig-1_t000010R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_014K10_contig-1_p000010 ID=Sh_014K10_contig-1_p000010|Name=Sh_014K10_contig-1_p000010|organism=R570 Sugarcane cultivar|type=polypeptide|length=67bp
MARAVLVAVVLMQCCNMIVTARPLLETPAVAGGPTGTSSWLGLIMQVLGG
PGGNNTGCHAPNGSCP*
back to top