Sh_014K10_contig-1_p000080

Overview
NameSh_014K10_contig-1_p000080
Unique NameSh_014K10_contig-1_p000080
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length791
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_014K10_contig-1contigSh_014K10_contig-1:45073..47445
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR002885
InterProIPR033443
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_014K10_contig-1_t000080Sh_014K10_contig-1_t000080R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_014K10_contig-1_p000080 ID=Sh_014K10_contig-1_p000080|Name=Sh_014K10_contig-1_p000080|organism=R570 Sugarcane cultivar|type=polypeptide|length=791bp
MLTPCDSFLHVPAQPRTPLPDLTAPASWKENVLNFQIRAVSAPARTAEIC
PKLVVPCSVPKQTVGGKKKGNWVHYGGSLPEMLEALEHVRDVGEALWAWK
DTLSNRERTIILKEQKDWRRAVEIFDWFRRERGHELNVIHYNVMLYTVGK
ARRWDLVLRLWHEMHSFGVVPDNLTYGTLINVCCQGGSEWAALLWLGDMC
KRGLMPDEVTMNIVMQALKKAGEYETAELFFERWSLDSIRRMKGRSHCSL
YTYNTLIDTYGKAGHLEKVADTFNQMLTEGVAPSVVTFNSMIHAWGKHHR
MEQVASLVRMMEEFQCFPDTRTYNILIALYRESNDIDIAESYYWKMKTEN
LVPDAVSCRTLLYGFSIRGMVTKVEALLKEMDERGFVVDEYTQSALTRMY
VNVGMLEQAWRWFDRFHHHMSSECFSANIDAFGEKGYIVLAEKAFICCLK
KKMLSVSACNVMIKAYGLVEKLDEACEIADGMERYGILPDYVTYASLIQL
LSAAKLPKKAIYYLEKMKVVKLLTDCIPYSVVISSFAKNSDLRMAEYLFR
EMIMSGVRPDVFVYSILIDAYAEVGNVQQASAYFGLMKKDGLYENVTIYN
SLIKLYTKVGYVAEARETYKLLKSLDNNAILYASNCMIDLYSDHWMVKEA
CEVFEGLKVRGIANEFSHAMMVCMYKKVGRYDVAHRICKEMQALGLLTQL
LSYNSVIQTYVSGGRTEEALKIFKKMLASNTPPNDATFQALKVILVRSGV
TKNETRKLELLRRNNTHDCLRQWYRALSSAVRSSANSFQT*
back to top