Sh_014K10_contig-1_p000090

Overview
NameSh_014K10_contig-1_p000090
Unique NameSh_014K10_contig-1_p000090
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length534
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_014K10_contig-1contigSh_014K10_contig-1:49774..54183
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR013601
InterProIPR016039
InterProIPR012392
InterProIPR013747
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_014K10_contig-1_t000090Sh_014K10_contig-1_t000090R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_014K10_contig-1_p000090 ID=Sh_014K10_contig-1_p000090|Name=Sh_014K10_contig-1_p000090|organism=R570 Sugarcane cultivar|type=polypeptide|length=534bp
MANQQYRSSIAMDRELFRTVRQAALNHARLLYHRLVSRLPHLLAVTFLVA
AAQLVPMPPSPSAPLPPVGALLREAAARARPDAGLVAAALAGVAACACAY
AALRPRPVYLVDLAAYRPGPAHRATRAESVHHFALAGPFTDESVAFQTRM
LERAGVGDATHFPASILAVPVDMSLRAAREESEAVVFGVVDDLLRTTAVR
AADVGVVIVNSSLFSPTPSFTSLLVNRYGLRHDVVTHNLSGMGCSAGIIA
IDLARHLLQVHPDTYALVVSTENITLNAYLGNHRPMLVTNTLFRMGGAAV
LLSNRAADRSRAKYRLVHTVRTHRGGASDDSYACVTQEEDGEGNVGVSLS
KNLMSVAGDALRSNITTLGPLVLPLSEQLRFLAAALLRRVAGVKPYVPDF
KLALEHFCIHAGGRGVLDELERSLGLSAWHMEPSRMTLYRFGNTSSSSLW
YELAYCEAKGRIKKGDRVWQIAFGSGFKCNSAVWKALRTVDDAGRETNNP
WADDIHDLPVHVPKVSPFASSDQQAASTNGQHA*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0016747transferase activity, transferring acyl groups other than amino-acyl groups
GO:0003824catalytic activity
Vocabulary: Biological Process
TermDefinition
GO:0006633fatty acid biosynthetic process
GO:0008152metabolic process
Vocabulary: Cellular Component
TermDefinition
GO:0016020membrane