Sh_017D22_p000110

Overview
NameSh_017D22_p000110
Unique NameSh_017D22_p000110
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length211
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_017D22contigSh_017D22:143081..145579
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR025659
InterProIPR007612
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_017D22_t000110Sh_017D22_t000110R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_017D22_p000110 ID=Sh_017D22_p000110|Name=Sh_017D22_p000110|organism=R570 Sugarcane cultivar|type=polypeptide|length=211bp
MERHTSALALAPSPAPVAVVSSQFCAPHVVPLTVTKKAMSFSGGDFTVTD
DASGAVVLRVRGTYLSVRSHRVLHDAAGRAILTMQRKVFSMHEKWKVFRG
DSTAANDLLFTVKKTSIFQLKTKLDVFLAGNTTAEQVCDFKIKGSYFERS
CAFYRGNSNVLIAQMNRNFTLSNVLLGKDTYSVSVFPHVDYVFIAALVVI
LDEIHRDRSK*
back to top