Sh_017F02_t000060

Overview
NameSh_017F02_t000060
Unique NameSh_017F02_t000060
TypemRNA
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length1887
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_017F02contigSh_017F02:118724..123702
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Properties
Property NameValue
NotePutative Pentatricopeptide repeat-containing protein At2g22070
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
Sh_017F02_g000060Sh_017F02_g000060R570 Sugarcane cultivargene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Sh_017F02_p000060Sh_017F02_p000060R570 Sugarcane cultivarpolypeptide


Sequences
The following sequences are available for this feature:

mRNA sequence

>Sh_017F02_t000060 ID=Sh_017F02_t000060|Name=Sh_017F02_t000060|organism=R570 Sugarcane cultivar|type=mRNA|length=1887bp
ATGTTACCTAGCCTGTCTAGCTTGACTAGTAGTTTCTTTGCTTGTTCAAA
CATCGAAGCTCTTGAGACAGGAAAACAAGTTCATTCACTTGCAGTAAAGG
CTGGCTGTCAGTTTAATAGCTATGTATGTAATGCACTGATTACTCTGTAC
GCTAAGTGCAGAAACATAGGTTTTGTGAGACAAATCTTTGATCGGATGAC
AGTTAAAGATACAGTGTCTTATAACTCTTTTATGACCGCACTTGTACAAA
ATAATCTGCTTGATGAAGCAAGAGATATATTTGACAATATGCCAAGTCGA
GATGTTGTCTCTTGGACTATGATAATATCTGCATATGCACAAGCTGATCA
GGGGAATGAGGCTGTAGAGATTTTCAGAAGTATGCTGCATGATCGTGAGT
TACCCAATCCACCTATATTAACTATAGTTCTTGGCCTTGGTGGAAGTCTT
GGTGCTCCCAAACTTGGACAGCAAATTCACACAGTCGCTATTAAACTTGG
AATGGATTCAGGACTTGTAGTGGCTAATGCTCTTGTCTCGATGTATTTCA
AGTGCGGTTCTGCAGATTCCCTTAAGGTTTTTGATTCAATGGAGGAGCGG
GACATTTTTACATGGAATACTGTCATTACAGGCTATGCTCAGCATGGCCT
TGGAAGAGAAGCCATCAGGATGTATCGACTAATGGTATCTGCTGGAGTGT
TGCCTAACGAGGTCACTTTTGTGGGGCTTTTACATGCATGTAGTCATTCT
GGTTTGGTTAATGAAGGACGCCAGTTTTTCAAGTCTATGAGCATTGATTA
TGGACTAACTCCTCTGCTGGAGCACTATGCTTGCATGGCCGACCTACTTG
GGCGAGCTGGTGATGTGCATGGAGCTGAACAGTTTATTTATGATATGCCT
ATTGAGCCAGATTCAGTGATCTGGAGTGCACTTCTTGGGGCATGCAAGAT
TCACAAGAATGTAGAAATTGGTACCAGAGCAGCTGAGAAACTTTTCTGTA
TCGATCCATCAAATGCTGGGAATTATGTCATGTTGTCAAATATATACTCC
TCTCAAGGGATGTGGGATGAAGTTGCGAAGGTACGAAAACTTATGAAAGA
ACAAGGTGTGAACAAGGATCCTGGTTGTAGCTGGATGCAGATAAAGAACA
AAATGCACTCATTTGTCACTGGAGATGAGGAACATGAGCAAATTCAAGAT
ATATATGCTACCCTTTGGGAGTTATACACTTCACTAAAGGCCACAGGTTA
TGTACCTGACACGGACTTTGTTCTCCATGACATAGATGAAGAGCAGAAGG
AAAGGTTGCTTCTGTACCACAGTGAGAAGCTTGCTGTTGCTTATGGGCTT
CTTGCTACACCCAAGGGCATGCCCATACAGATAATGAAGAACCTTAGAAT
ATGTGGTGACTGTCACACTTTCATCAAATTTGTATCCTATGTCACCAAGA
GAGAAATTGACGTTAGGGATGGGAATCGATTCCATCATTTCAGGAATGGA
AGCTGTGCATGTGGATTTTGCTACGTGGTATTCTCAATGGGTTACACAAA
AGTTGGCATAAAGATGGGTTTGTACACTAGAAAATTAACGCCTGTCCACA
TAAAGTTTGAATTGAATGCAGAGCAAAGCAAGATTCCTTATATGATGTGT
TTCTTATCATTGTTGATGTTTTTCCCTGGATTGCCTTTTGATAGTCTCAT
AATATGCATTCCATTGATGTTAAGTCTTGCCTCACTGGTGATAAAGACCA
AGAATGGCCAGGCAGGCAAGGAGAAATCCTCCTGGAGAACTGCATGTCAT
TTCGTTGTTAAGAAGAAGAGAGAAATACAAAGGAGAGAGGGGGTGCCATT
TCCAGATCTTGATTCTGGACAAGAGTGGAGGCGATGA
back to top

protein sequence of Sh_017F02_p000060

>Sh_017F02_p000060 ID=Sh_017F02_p000060|Name=Sh_017F02_p000060|organism=R570 Sugarcane cultivar|type=polypeptide|length=629bp
MLPSLSSLTSSFFACSNIEALETGKQVHSLAVKAGCQFNSYVCNALITLY
AKCRNIGFVRQIFDRMTVKDTVSYNSFMTALVQNNLLDEARDIFDNMPSR
DVVSWTMIISAYAQADQGNEAVEIFRSMLHDRELPNPPILTIVLGLGGSL
GAPKLGQQIHTVAIKLGMDSGLVVANALVSMYFKCGSADSLKVFDSMEER
DIFTWNTVITGYAQHGLGREAIRMYRLMVSAGVLPNEVTFVGLLHACSHS
GLVNEGRQFFKSMSIDYGLTPLLEHYACMADLLGRAGDVHGAEQFIYDMP
IEPDSVIWSALLGACKIHKNVEIGTRAAEKLFCIDPSNAGNYVMLSNIYS
SQGMWDEVAKVRKLMKEQGVNKDPGCSWMQIKNKMHSFVTGDEEHEQIQD
IYATLWELYTSLKATGYVPDTDFVLHDIDEEQKERLLLYHSEKLAVAYGL
LATPKGMPIQIMKNLRICGDCHTFIKFVSYVTKREIDVRDGNRFHHFRNG
SCACGFCYVVFSMGYTKVGIKMGLYTRKLTPVHIKFELNAEQSKIPYMMC
FLSLLMFFPGLPFDSLIICIPLMLSLASLVIKTKNGQAGKEKSSWRTACH
FVVKKKREIQRREGVPFPDLDSGQEWRR*
back to top

mRNA from alignment at Sh_017F02:118724..123702+

Legend: polypeptideCDSexon
Hold the cursor over a type above to highlight its positions in the sequence below.
>Sh_017F02_t000060 ID=Sh_017F02_t000060|Name=Sh_017F02_t000060|organism=R570 Sugarcane cultivar|type=mRNA|length=4979bp|location=Sequence derived from alignment at Sh_017F02:118724..123702+ (R570 Sugarcane cultivar)
ATGTTACCTAGCCTGTCTAGCTTGACTAGTAGTTTCTTTGCTTGTTCAAA CATCGAAGCTCTTGAGACAGGAAAACAAGTTCATTCACTTGCAGTAAAGG CTGGCTGTCAGTTTAATAGCTATGTATGTAATGCACTGATTACTCTGTAC GCTAAGTGCAGAAACATAGGTTTTGTGAGACAAATCTTTGATCGGATGAC AGTTAAAGATACAGTGTCTTATAACTCTTTTATGACCGCACTTGTACAAA ATAATCTGCTTGATGAAGCAAGAGATATATTTGACAATATGCCAAGTCGA GATGTTGTCTCTTGGACTATGATAATATCTGCATATGCACAAGCTGATCA GGGGAATGAGGCTGTAGAGATTTTCAGAAGTATGCTGCATGATCGTGAGT TACCCAATCCACCTATATTAACTATAGTTCTTGGCCTTGGTGGAAGTCTT GGTGCTCCCAAACTTGGACAGCAAATTCACACAGTCGCTATTAAACTTGG AATGGATTCAGGACTTGTAGTGGCTAATGCTCTTGTCTCGATGTATTTCA AGTGCGGTTCTGCAGATTCCCTTAAGGTTTTTGATTCAATGGAGGAGCGG GACATTTTTACATGGAATACTGTCATTACAGGCTATGCTCAGCATGGCCT TGGAAGAGAAGCCATCAGGATGTATCGACTAATGGTATCTGCTGGAGTGT TGCCTAACGAGGTCACTTTTGTGGGGCTTTTACATGCATGTAGTCATTCT GGTTTGGTTAATGAAGGACGCCAGTTTTTCAAGTCTATGAGCATTGATTA TGGACTAACTCCTCTGCTGGAGCACTATGCTTGCATGGCCGACCTACTTG GGCGAGCTGGTGATGTGCATGGAGCTGAACAGTTTATTTATGATATGCCT ATTGAGCCAGATTCAGTGATCTGGAGTGCACTTCTTGGGGCATGCAAGAT TCACAAGAATGTAGAAATTGGTACCAGAGCAGCTGAGAAACTTTTCTGTA TCGATCCATCAAATGCTGGGAATTATGTCATGTTGTCAAATATATACTCC TCTCAAGGGATGTGGGATGAAGTTGCGAAGGTACGAAAACTTATGAAAGA ACAAGGTGTGAACAAGGATCCTGGTTGTAGCTGGATGCAGATAAAGAACA AAATGCACTCATTTGTCACTGGAGATGAGGAACATGAGCAAATTCAAGAT ATATATGCTACCCTTTGGGAGTTATACACTTCACTAAAGGCCACAGGTTA TGTACCTGACACGGACTTTGTTCTCCATGACATAGATGAAGAGCAGAAGG AAAGGTTGCTTCTGTACCACAGTGAGAAGCTTGCTGTTGCTTATGGGCTT CTTGCTACACCCAAGGGCATGCCCATACAGATAATGAAGAACCTTAGAAT ATGTGGTGACTGTCACACTTTCATCAAATTTGTATCCTATGTCACCAAGA GAGAAATTGACGTTAGGGATGGGAATCGATTCCATCATTTCAGGAATGGA AGCTGTGCATGTGGTGATTTTTGGTGATAAATTATCCGAGCACCAGCAGG TCTTCTTCACACTATCCCCTCAAACACAGGTTGCCTAATTTCTTCACCCA TGTTTTAGTTTCCCTTTAGTTTCTATGTGTATCTAAATCCTTTTTCATGT TATCCCAATTGATCAAAGAGGATTTTGCTACGTGGTATTCTCAATGGGTT ACACAAAAGTTGGCATAAAGATGGGTTTGTACACTAGAAAATTAACGCCT GTCCACATAAAGTTTGAATTGAATGCAGAGCAAAGCAAGATTCCTTATAT GATGTGTTTCTTATCATTGTTGATGTTTTTCCCTGGATTGCCTTTTGATA GTCTCATAGTGTAGTTAATCCTGTAATTCCTGTTATCATATGACTGACTG GTGTTTTGTACATTTCTTATCAAGGCTGGATGCAGGAAGAGGCAATACCT TACCTCTTGAATGTTCATCTCTATATTAAGGAGGTCATCCTTAGGTTAGT CATTTCGTCATCACCATACCATTATAAAAATAATTGATTGATTGATTGAT TACGATATCGTTGTGTTCTTTCTACTGAATGTTTATGCTTTGGTGTTCTA AGTTCTGCTGTAATCTGCACAGATATGCATTCCATTGATGTTAAGTCTTG CCTCACTGGTGTCTGCTTCTGATGGTGTGGCTACCTGAGCAGCTTCTACC AATTCTGCCTTAGCTTGCCAATTAACGTGTTCACCAGGACAGAGCTGAAA GTGTGAAATGGCAAGACCACAACCCTGAAGTTGAAGCGTTGGTAAGAAAC TCAGATAGGTGGATAAATGTTGAGCCACCTTTTTTTTTTGAACCGGGGAG CCTTTTCTCCTCATTCCCGTGCACTGTGCACGGAAATACCGCGGTCACCG GGGTTCGAAACCGGGGTGGCCAGGCAGGGCCTTTGGCTCCATGCGCTAGC CACCAGCAGCTGCCGCTAAATGTTGAGCCACCTAGCTATAAAGACAGATG GTAGGTGTTGGAACTTGGAAGGCCATGCGGCTCCCTTGTTTTTTTTTTCC TCGAAAATGCAAGAGAACTGCGCTTCATTCTATTAAGAAGAAATGCGGCT CCCTTGTTATGAACCACATCAGGAATTGTGGAAAGCTCAAGAACCACACT TTCCTAAATGGAAGAAAGGTAACAAATTTCAGGTAAAGGAGATAAGGTAA ACCCTTACAAAGTTAGCAATCGTGATGAGAAATTCCAGAAAAGAGGAAGA AGATTTTGAAGGAAAAAGTGCTCAAAGTAGATGTGCAATATGAGCTGTGA GCTTTCCCCCTACATTCTTCTGATGTCACATCAAGGATAAAGACCAAGAA TGGCCAGGCAGGCAAGGAGAAATCCTCCTGGTAGGTCTCTCTACCATAAA ACTTGATCGTCAATGACAGCGCTGTATTATATCTCTCTTTTTTTTTAAAA AAAAGAAGTGCTTCTGAAGCCTTGCAGGGTACATCTGTCCTACTCGTCTT TGTTATCCTTTTATTCTAGGAATTGTACTCAATAATTTGTTTGTCGGGTT GCAGTACAAGATTAATTCTGAGTGCAACTTTTTTTTCCTTCTTGATTCTG TTTGGCCTGCAATTGGAATGGTAGTAGACGTAGTGACTGCAACGAATTGA TAGCGTTGGACAGTATGAGAACCCAAGATTTATAAAAAGCTTAATTCAGC TGGTCTCATATTTTCTAGCAGAGCCATATCGAATTCTTTTTAGGGTTTGT TGTTTATAAAAATGGTGAATGCAGGAATAGAACAGTTGTTGATGTGGTCT GTAAATGGCAAATGTGATCTGCACAAACAATATGCCAAGTTGTGAATATT AATTTTTGGCCATGCACAAATCTTAGAATAGAATTATGTTCATCGTCTGC CTTCTAGTTTATTTCCTATTCTTCTAGGTTCATCCTTTTATATCCTACTC TTCACTATTTTCTTTATTATAGCCGTCTAAGGTTCAGATTTTTTTCCTCA AACTTTGTAGGAGAACTGCATGTCATTTCGTTGTTAAGAAGAAGAGAGAA ATACAAAGGAGAGAGGGGGTGCCATTTCCAGATCTTGATTCTGGACAAGG TTAGTACAATGTGTCCTACATATGAATCTAGGATGTTACTTTGATAATGA CAAGCACCTTAATTGTGGCTTTCAAACTGCATGGCTTTTTTACACTACTT GTGAATAAAATTATATGGAGAAAAATCAGAAATTGATGTTACTTTGAGAA ATTAAATAAAACAAACAAGACAGAGAAAAACTGTAATACACAAATATAAC AAACACACTGAATATCATAACTCATGTCACACGGTATGTTTCATGTTTGC TTAATGTGTCATCTAGGGATCATCATTCTTGTCATGATCCAATATCGTAT TAGATGGACTGGAAGTTGAAAGAATTAAAAACCTGTGACATGCTAGATTT GATAAACTTAGCTATTATTCAAGTATATTTGATGCAGTTTGCTCTAATTT AGTCACTTTATGGCACAGGCACTCTTTGCATCTTTCATGGTGGATGTGTG GTTATAACTGCATTTTAAAACATTTATGTTCAAACTGAAAGGGAAGGAAA CTTTTAGCCTTGGTAGGAGGTGAAGGACATAGCAAATCCTCAGAAAAAGC AACTTTCACGTCCTAACCTTGTGTTGACTACTGAATTGTCAATGCATACG TTTTTAGAGAATTATACATTCCCTTGGATTTTTTTAACATGCTAGTTATA ACCACAGGCTCTGGGTCCACTGCGTTGTACTATACATCATCTCTGCTGTA GCTTGCATTCTTCTATACTTGGTATGATCGAGTAGTATAGCCATTAAAAT TTGTTAAGTAGTGTTATGTTACCTTATGATAAGGAACTTATATTATTAGG TGACGTTTCTTTAGGAGTACAAGCACAATGCCAGGCTGAGGTTATATCAC ATTTCTCGAGCAACAAGCAATCCTAGCCTTTTACTGTCCTTGTCCGAGGA ATACCAAAAGCAAGCACTGAATCATTCAGAGTTTTTTTTTTTTGATAACT GGCAAACTTTATTAACAGCAAGAAGCTGTTGTGAGGGAGACACTCCCAAG ATACAGAAGTCAGAGCTTCCCTTAAGGGGCATCTGAATACATGAGCCTGG TTTGAGCAGGTAATGGACAGAGCATGAGGATACAGAGATGTAGAACGAGT ACCTTGAGTAGCTAGTAGGTGCGCCGTGGAGTTGAGATTTCTTGCTATTT TGAAGACCTTGTAGTTGTTTTGCTGCATTGAAGTTGATGAACTTCTGAGT ATAATGTTTGATATCCCAGAGTGGAGGCGATGAGTGATTGGAGCCATTGA AGGTCACCAATTGTTGGCTGTCTGTTAGGAAGATTGGACTTGGAATGTCC ATTGCAGAGACCACCGAAGCCGCCAAGGCCAAAGCTGCCGCCTCAGCCAT AAGCACTGAAGAGGTGCTGTGCATAATTG
back to top

Coding sequence (CDS) from alignment at Sh_017F02:118724..123702+

>Sh_017F02_t000060 ID=Sh_017F02_t000060|Name=Sh_017F02_t000060|organism=R570 Sugarcane cultivar|type=CDS|length=1887bp|location=Sequence derived from alignment at Sh_017F02:118724..123702+ (R570 Sugarcane cultivar)
ATGTTACCTAGCCTGTCTAGCTTGACTAGTAGTTTCTTTGCTTGTTCAAA
CATCGAAGCTCTTGAGACAGGAAAACAAGTTCATTCACTTGCAGTAAAGG
CTGGCTGTCAGTTTAATAGCTATGTATGTAATGCACTGATTACTCTGTAC
GCTAAGTGCAGAAACATAGGTTTTGTGAGACAAATCTTTGATCGGATGAC
AGTTAAAGATACAGTGTCTTATAACTCTTTTATGACCGCACTTGTACAAA
ATAATCTGCTTGATGAAGCAAGAGATATATTTGACAATATGCCAAGTCGA
GATGTTGTCTCTTGGACTATGATAATATCTGCATATGCACAAGCTGATCA
GGGGAATGAGGCTGTAGAGATTTTCAGAAGTATGCTGCATGATCGTGAGT
TACCCAATCCACCTATATTAACTATAGTTCTTGGCCTTGGTGGAAGTCTT
GGTGCTCCCAAACTTGGACAGCAAATTCACACAGTCGCTATTAAACTTGG
AATGGATTCAGGACTTGTAGTGGCTAATGCTCTTGTCTCGATGTATTTCA
AGTGCGGTTCTGCAGATTCCCTTAAGGTTTTTGATTCAATGGAGGAGCGG
GACATTTTTACATGGAATACTGTCATTACAGGCTATGCTCAGCATGGCCT
TGGAAGAGAAGCCATCAGGATGTATCGACTAATGGTATCTGCTGGAGTGT
TGCCTAACGAGGTCACTTTTGTGGGGCTTTTACATGCATGTAGTCATTCT
GGTTTGGTTAATGAAGGACGCCAGTTTTTCAAGTCTATGAGCATTGATTA
TGGACTAACTCCTCTGCTGGAGCACTATGCTTGCATGGCCGACCTACTTG
GGCGAGCTGGTGATGTGCATGGAGCTGAACAGTTTATTTATGATATGCCT
ATTGAGCCAGATTCAGTGATCTGGAGTGCACTTCTTGGGGCATGCAAGAT
TCACAAGAATGTAGAAATTGGTACCAGAGCAGCTGAGAAACTTTTCTGTA
TCGATCCATCAAATGCTGGGAATTATGTCATGTTGTCAAATATATACTCC
TCTCAAGGGATGTGGGATGAAGTTGCGAAGGTACGAAAACTTATGAAAGA
ACAAGGTGTGAACAAGGATCCTGGTTGTAGCTGGATGCAGATAAAGAACA
AAATGCACTCATTTGTCACTGGAGATGAGGAACATGAGCAAATTCAAGAT
ATATATGCTACCCTTTGGGAGTTATACACTTCACTAAAGGCCACAGGTTA
TGTACCTGACACGGACTTTGTTCTCCATGACATAGATGAAGAGCAGAAGG
AAAGGTTGCTTCTGTACCACAGTGAGAAGCTTGCTGTTGCTTATGGGCTT
CTTGCTACACCCAAGGGCATGCCCATACAGATAATGAAGAACCTTAGAAT
ATGTGGTGACTGTCACACTTTCATCAAATTTGTATCCTATGTCACCAAGA
GAGAAATTGACGTTAGGGATGGGAATCGATTCCATCATTTCAGGAATGGA
AGCTGTGCATGTGGATTTTGCTACGTGGTATTCTCAATGGGTTACACAAA
AGTTGGCATAAAGATGGGTTTGTACACTAGAAAATTAACGCCTGTCCACA
TAAAGTTTGAATTGAATGCAGAGCAAAGCAAGATTCCTTATATGATGTGT
TTCTTATCATTGTTGATGTTTTTCCCTGGATTGCCTTTTGATAGTCTCAT
AATATGCATTCCATTGATGTTAAGTCTTGCCTCACTGGTGATAAAGACCA
AGAATGGCCAGGCAGGCAAGGAGAAATCCTCCTGGAGAACTGCATGTCAT
TTCGTTGTTAAGAAGAAGAGAGAAATACAAAGGAGAGAGGGGGTGCCATT
TCCAGATCTTGATTCTGGACAAGAGTGGAGGCGATGA
back to top