Sh_019D17_contig-1_p000090

Overview
NameSh_019D17_contig-1_p000090
Unique NameSh_019D17_contig-1_p000090
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length462
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_019D17_contig-1contigSh_019D17_contig-1:56236..58814
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR006168
InterProIPR006109
InterProIPR013328
InterProIPR016040
InterProIPR011128
InterProIPR008927
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_019D17_contig-1_t000090Sh_019D17_contig-1_t000090R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_019D17_contig-1_p000090 ID=Sh_019D17_contig-1_p000090|Name=Sh_019D17_contig-1_p000090|organism=R570 Sugarcane cultivar|type=polypeptide|length=462bp
MVGSYANGGGAAALVAEEKLDALRRLLGKSDGDPLRVVGVGAGAWGSVFC
ALLQDAYGRHRDRVQVRVWRRPGRAVDRADAERLFEVINSREDVLRRLIR
RCAYLKYVEARLGDRTLHADEILRDGFCLNMLDTPLCPLKVVTNLQEAVW
DADIVVNGLPSTETREVFEEIRRYWKERITQPLIISLAKGIEASLDPVPR
IITPTQMISNATGVPLENILYLGGPNIASEIYNKEYANARICGADKWRKP
LANFLRQPHFIVWDNSDLITHEVMGGLKNVYAIGAGMVAALTNESATSKS
VYFSLCTSEMIYITHLLAREPEKLAGPLLADTYVTLLKGRNAWYGQKLAK
GELTLEMGDSIKGKGTIQGVSAVNAFYELLSQGSLSVMHPETKKAVAPVE
LCPILKTLYKILIKRELTTNSILQAIRDESMYDPRERIELAQRQSLYRPS
LLGLPKGDAKA*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0004367glycerol-3-phosphate dehydrogenase [NAD+] activity
GO:0016491oxidoreductase activity
GO:0016616oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0051287NAD binding
Vocabulary: Biological Process
TermDefinition
GO:0006072glycerol-3-phosphate metabolic process
GO:0055114oxidation-reduction process
GO:0005975carbohydrate metabolic process
GO:0046168glycerol-3-phosphate catabolic process
Vocabulary: Cellular Component
TermDefinition
GO:0009331glycerol-3-phosphate dehydrogenase complex