Sh_019F03_p000120

Overview
NameSh_019F03_p000120
Unique NameSh_019F03_p000120
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length398
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_019F03contigSh_019F03:69872..72685
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
EC2.7.1.134
EC2.7.1.159
InterProIPR008656
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_019F03_t000120Sh_019F03_t000120R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_019F03_p000120 ID=Sh_019F03_p000120|Name=Sh_019F03_p000120|organism=R570 Sugarcane cultivar|type=polypeptide|length=398bp
MLEWSRTSFCFYVTSRVDKGLISELQNQNWRVLSVGNECNIDVPGVLNVQ
RLQELLLTLASLIKRHEHHAFSSCLQRGAFPIYPSKDSLIFVPLSFELPL
SLQLQEVDMVLHKITDEIVKIDPNCSINFPKGISFSAGMFEIIRFVEEHP
DFCIMDPFKNIYPLLDRLQIQKILVRLQELGAEEKPKLRAPYSLKVDNFH
DGELDKHLAEANLSFPLIVKPQVACGVADAHNMVSVTHQLKNILQEYVDH
GSKIFKFYVIGDKVFYAVRDSMPNARFLKSSSGGAWYYNTEVCLNLAYLS
LKTLPVATKEQQLQTGVQDSKLLDANLVEEAAKFLKGLLGLTIFGFDVVV
QEGTGDHVIVDLNYLPSFKEVPDSEAVPAFWDAVRQAYKSRRGNAQV*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0000287magnesium ion binding
GO:0005524ATP binding
GO:0047325inositol tetrakisphosphate 1-kinase activity
GO:0052725inositol-1,3,4-trisphosphate 6-kinase activity
GO:0052726inositol-1,3,4-trisphosphate 5-kinase activity
Vocabulary: Biological Process
TermDefinition
GO:0032957inositol trisphosphate metabolic process
Vocabulary: Cellular Component
TermDefinition
GO:0005622intracellular